Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 2706073..2706632 Replicon chromosome
Accession NZ_CP118580
Organism Vibrio harveyi strain fish3

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PWW32_RS12730 Protein ID WP_274882184.1
Coordinates 2706354..2706632 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PWW32_RS12725 Protein ID WP_274882183.1
Coordinates 2706073..2706357 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW32_RS12670 2701642..2701731 - 90 WP_072611848.1 DUF3265 domain-containing protein -
PWW32_RS12675 2701749..2702435 - 687 WP_199450652.1 HNH endonuclease -
PWW32_RS12680 2702504..2702596 - 93 Protein_2415 DUF3265 domain-containing protein -
PWW32_RS12685 2702611..2703015 - 405 WP_213971719.1 hypothetical protein -
PWW32_RS12690 2703017..2703943 - 927 WP_072615077.1 AAA family ATPase -
PWW32_RS12695 2703991..2704080 - 90 WP_140280429.1 DUF3265 domain-containing protein -
PWW32_RS12700 2704106..2704645 - 540 WP_274882181.1 hypothetical protein -
PWW32_RS12705 2704684..2704773 - 90 WP_075984317.1 DUF3265 domain-containing protein -
PWW32_RS12710 2704791..2705288 - 498 WP_274882182.1 DNA topology modulation protein -
PWW32_RS12715 2705438..2705920 - 483 WP_155414574.1 hypothetical protein -
PWW32_RS12720 2705905..2705996 - 92 Protein_2423 DUF3265 domain-containing protein -
PWW32_RS12725 2706073..2706357 + 285 WP_274882183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PWW32_RS12730 2706354..2706632 + 279 WP_274882184.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWW32_RS12735 2706769..2707428 - 660 WP_140388274.1 HAD family hydrolase -
PWW32_RS12740 2707884..2708288 - 405 WP_274882185.1 hypothetical protein -
PWW32_RS12745 2708828..2709301 - 474 WP_227740521.1 DUF4476 domain-containing protein -
PWW32_RS12750 2709336..2709428 - 93 WP_079856868.1 DUF3265 domain-containing protein -
PWW32_RS12755 2709791..2709985 - 195 WP_274882186.1 hypothetical protein -
PWW32_RS12760 2710083..2710174 - 92 Protein_2431 DUF3265 domain-containing protein -
PWW32_RS12765 2710189..2710914 - 726 WP_274882187.1 TIGR02391 family protein -
PWW32_RS12770 2711056..2711148 - 93 WP_004418565.1 DUF3265 domain-containing protein -
PWW32_RS12775 2711173..2711544 - 372 WP_045402250.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2666083..2739845 73762
- inside Integron - - 2673242..2739845 66603


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(1-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10919.59 Da        Isoelectric Point: 4.3430

>T273248 WP_274882184.1 NZ_CP118580:2706354-2706632 [Vibrio harveyi]
MILWEEESLNDRERIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11085.40 Da        Isoelectric Point: 9.2167

>AT273248 WP_274882183.1 NZ_CP118580:2706073-2706357 [Vibrio harveyi]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTSKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References