Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 2682152..2682711 Replicon chromosome
Accession NZ_CP118580
Organism Vibrio harveyi strain fish3

Toxin (Protein)


Gene name relE Uniprot ID A0A347UR22
Locus tag PWW32_RS12445 Protein ID WP_005398411.1
Coordinates 2682433..2682711 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR21
Locus tag PWW32_RS12440 Protein ID WP_005398409.1
Coordinates 2682152..2682436 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW32_RS12370 2677286..2677834 - 549 WP_203346253.1 hypothetical protein -
PWW32_RS12375 2678108..2678416 + 309 WP_274791737.1 hypothetical protein -
PWW32_RS12380 2678426..2678794 + 369 WP_274791736.1 HNH endonuclease signature motif containing protein -
PWW32_RS12385 2678867..2678986 - 120 WP_080573781.1 DUF3265 domain-containing protein -
PWW32_RS12390 2678983..2679426 - 444 WP_103155411.1 hypothetical protein -
PWW32_RS12395 2679457..2679546 - 90 WP_072615037.1 DUF3265 domain-containing protein -
PWW32_RS12400 2679564..2679953 - 390 WP_274791735.1 DUF4345 domain-containing protein -
PWW32_RS12405 2679993..2680085 - 93 WP_206635068.1 DUF3265 domain-containing protein -
PWW32_RS12410 2680106..2680837 - 732 WP_274791734.1 hypothetical protein -
PWW32_RS12415 2680926..2680994 - 69 Protein_2362 DUF3265 domain-containing protein -
PWW32_RS12420 2680998..2681264 - 267 WP_029863890.1 hypothetical protein -
PWW32_RS12425 2681368..2681457 - 90 WP_076665001.1 DUF3265 domain-containing protein -
PWW32_RS12430 2681509..2681934 - 426 WP_069525414.1 hypothetical protein -
PWW32_RS12435 2681984..2682075 - 92 Protein_2366 DUF3265 domain-containing protein -
PWW32_RS12440 2682152..2682436 + 285 WP_005398409.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PWW32_RS12445 2682433..2682711 + 279 WP_005398411.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
PWW32_RS12450 2682740..2682832 - 93 WP_196229928.1 DUF3265 domain-containing protein -
PWW32_RS12455 2682860..2683303 - 444 WP_017190363.1 hypothetical protein -
PWW32_RS12460 2683287..2683631 - 345 WP_017190364.1 hypothetical protein -
PWW32_RS12465 2683736..2683828 - 93 WP_079764584.1 DUF3265 domain-containing protein -
PWW32_RS12470 2683919..2684191 - 273 WP_009698352.1 hypothetical protein -
PWW32_RS12475 2684304..2684990 - 687 WP_047517854.1 GIY-YIG nuclease family protein -
PWW32_RS12480 2685018..2685107 - 90 WP_201258222.1 DUF3265 domain-containing protein -
PWW32_RS12485 2685125..2685577 - 453 WP_274791732.1 hypothetical protein -
PWW32_RS12490 2685603..2685692 - 90 WP_071881309.1 DUF3265 domain-containing protein -
PWW32_RS12495 2686177..2686611 - 435 WP_274791731.1 GNAT family N-acetyltransferase -
PWW32_RS12500 2686642..2686734 - 93 WP_199436720.1 DUF3265 domain-containing protein -
PWW32_RS12505 2686770..2687189 - 420 WP_077200592.1 hypothetical protein -
PWW32_RS12510 2687283..2687375 - 93 WP_274882176.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2666083..2739845 73762
- inside Integron - - 2673242..2739845 66603


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10891.57 Da        Isoelectric Point: 4.3430

>T273247 WP_005398411.1 NZ_CP118580:2682433-2682711 [Vibrio harveyi]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11069.40 Da        Isoelectric Point: 9.2167

>AT273247 WP_005398409.1 NZ_CP118580:2682152-2682436 [Vibrio harveyi]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR22

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR21

References