Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 2671608..2672155 Replicon chromosome
Accession NZ_CP118580
Organism Vibrio harveyi strain fish3

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PWW32_RS12310 Protein ID WP_258455559.1
Coordinates 2671608..2671910 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A454B3H2
Locus tag PWW32_RS12315 Protein ID WP_005445660.1
Coordinates 2671898..2672155 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW32_RS12275 2667178..2667423 - 246 WP_222326331.1 hypothetical protein -
PWW32_RS12280 2668089..2668340 - 252 WP_017817975.1 DUF2442 domain-containing protein -
PWW32_RS12285 2669587..2670018 - 432 WP_045490299.1 GNAT family N-acetyltransferase -
PWW32_RS12290 2670226..2670642 - 417 WP_274791743.1 hypothetical protein -
PWW32_RS12295 2670698..2670817 - 120 WP_080585338.1 DUF3265 domain-containing protein -
PWW32_RS12300 2670811..2671083 - 273 WP_050903611.1 hypothetical protein -
PWW32_RS12305 2671412..2671564 + 153 Protein_2340 IS30 family transposase -
PWW32_RS12310 2671608..2671910 - 303 WP_258455559.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWW32_RS12315 2671898..2672155 - 258 WP_005445660.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWW32_RS12320 2672354..2672509 - 156 WP_017190350.1 hypothetical protein -
PWW32_RS12325 2672506..2672685 - 180 WP_017190351.1 hypothetical protein -
PWW32_RS12330 2672723..2672947 - 225 WP_274791742.1 BrnT family toxin -
PWW32_RS12335 2673242..2673685 - 444 WP_274791741.1 GNAT family N-acetyltransferase -
PWW32_RS12340 2673822..2673890 - 69 Protein_2347 DUF3265 domain-containing protein -
PWW32_RS12345 2673887..2674186 - 300 WP_005536942.1 hypothetical protein -
PWW32_RS12350 2674325..2675710 - 1386 WP_274791740.1 hypothetical protein -
PWW32_RS12355 2675870..2676535 - 666 WP_274791739.1 hypothetical protein -
PWW32_RS12360 2676566..2676658 - 93 WP_079750026.1 DUF3265 domain-containing protein -
PWW32_RS12365 2676777..2676986 - 210 WP_274882175.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2666083..2739845 73762
- inside Integron - - 2673242..2739845 66603


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-90)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11623.59 Da        Isoelectric Point: 7.9971

>T273246 WP_258455559.1 NZ_CP118580:c2671910-2671608 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPDLKHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERGLRKFLLNKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9548.06 Da        Isoelectric Point: 7.3177

>AT273246 WP_005445660.1 NZ_CP118580:c2672155-2671898 [Vibrio harveyi]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKGKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A454B3H2

References