Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 2671608..2672155 | Replicon | chromosome |
| Accession | NZ_CP118580 | ||
| Organism | Vibrio harveyi strain fish3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PWW32_RS12310 | Protein ID | WP_258455559.1 |
| Coordinates | 2671608..2671910 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A454B3H2 |
| Locus tag | PWW32_RS12315 | Protein ID | WP_005445660.1 |
| Coordinates | 2671898..2672155 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWW32_RS12275 | 2667178..2667423 | - | 246 | WP_222326331.1 | hypothetical protein | - |
| PWW32_RS12280 | 2668089..2668340 | - | 252 | WP_017817975.1 | DUF2442 domain-containing protein | - |
| PWW32_RS12285 | 2669587..2670018 | - | 432 | WP_045490299.1 | GNAT family N-acetyltransferase | - |
| PWW32_RS12290 | 2670226..2670642 | - | 417 | WP_274791743.1 | hypothetical protein | - |
| PWW32_RS12295 | 2670698..2670817 | - | 120 | WP_080585338.1 | DUF3265 domain-containing protein | - |
| PWW32_RS12300 | 2670811..2671083 | - | 273 | WP_050903611.1 | hypothetical protein | - |
| PWW32_RS12305 | 2671412..2671564 | + | 153 | Protein_2340 | IS30 family transposase | - |
| PWW32_RS12310 | 2671608..2671910 | - | 303 | WP_258455559.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PWW32_RS12315 | 2671898..2672155 | - | 258 | WP_005445660.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PWW32_RS12320 | 2672354..2672509 | - | 156 | WP_017190350.1 | hypothetical protein | - |
| PWW32_RS12325 | 2672506..2672685 | - | 180 | WP_017190351.1 | hypothetical protein | - |
| PWW32_RS12330 | 2672723..2672947 | - | 225 | WP_274791742.1 | BrnT family toxin | - |
| PWW32_RS12335 | 2673242..2673685 | - | 444 | WP_274791741.1 | GNAT family N-acetyltransferase | - |
| PWW32_RS12340 | 2673822..2673890 | - | 69 | Protein_2347 | DUF3265 domain-containing protein | - |
| PWW32_RS12345 | 2673887..2674186 | - | 300 | WP_005536942.1 | hypothetical protein | - |
| PWW32_RS12350 | 2674325..2675710 | - | 1386 | WP_274791740.1 | hypothetical protein | - |
| PWW32_RS12355 | 2675870..2676535 | - | 666 | WP_274791739.1 | hypothetical protein | - |
| PWW32_RS12360 | 2676566..2676658 | - | 93 | WP_079750026.1 | DUF3265 domain-containing protein | - |
| PWW32_RS12365 | 2676777..2676986 | - | 210 | WP_274882175.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2666083..2739845 | 73762 | |
| - | inside | Integron | - | - | 2673242..2739845 | 66603 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11623.59 Da Isoelectric Point: 7.9971
>T273246 WP_258455559.1 NZ_CP118580:c2671910-2671608 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPDLKHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERGLRKFLLNKQ
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPDLKHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERGLRKFLLNKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|