Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 1560308..1560867 Replicon chromosome
Accession NZ_CP118576
Organism Vibrio harveyi strain fish1

Toxin (Protein)


Gene name relE Uniprot ID A0A347UR22
Locus tag PWW27_RS07165 Protein ID WP_005398411.1
Coordinates 1560589..1560867 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR21
Locus tag PWW27_RS07160 Protein ID WP_005398409.1
Coordinates 1560308..1560592 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW27_RS07115 1555958..1557172 - 1215 WP_009697324.1 DUF3644 domain-containing protein -
PWW27_RS07120 1557259..1557336 - 78 Protein_1381 DUF3265 domain-containing protein -
PWW27_RS07125 1558311..1558408 - 98 Protein_1382 DUF3265 domain-containing protein -
PWW27_RS07130 1558449..1558664 - 216 WP_104035132.1 hypothetical protein -
PWW27_RS07135 1558793..1558885 - 93 WP_010644587.1 DUF3265 domain-containing protein -
PWW27_RS07140 1558900..1559724 - 825 WP_274886434.1 hypothetical protein -
PWW27_RS07145 1559693..1559782 - 90 WP_077345960.1 DUF3265 domain-containing protein -
PWW27_RS07150 1559812..1560111 - 300 WP_274886435.1 hypothetical protein -
PWW27_RS07155 1560140..1560231 - 92 Protein_1388 DUF3265 domain-containing protein -
PWW27_RS07160 1560308..1560592 + 285 WP_005398409.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PWW27_RS07165 1560589..1560867 + 279 WP_005398411.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
PWW27_RS07170 1560896..1560988 - 93 WP_196298091.1 DUF3265 domain-containing protein -
PWW27_RS07175 1561023..1561331 - 309 WP_010448946.1 hypothetical protein -
PWW27_RS07180 1561479..1561874 - 396 WP_260262200.1 GNAT family N-acetyltransferase -
PWW27_RS07185 1561901..1561993 - 93 WP_274886436.1 DUF3265 domain-containing protein -
PWW27_RS07190 1562031..1562309 - 279 WP_274886437.1 hypothetical protein -
PWW27_RS07195 1562856..1562948 - 93 WP_080765011.1 DUF3265 domain-containing protein -
PWW27_RS07200 1562963..1563367 - 405 WP_274886438.1 hypothetical protein -
PWW27_RS07205 1563394..1563483 - 90 WP_109170471.1 DUF3265 domain-containing protein -
PWW27_RS07210 1563510..1563890 - 381 WP_274886439.1 DUF4087 domain-containing protein -
PWW27_RS07215 1564007..1564462 - 456 WP_017191321.1 GNAT family N-acetyltransferase -
PWW27_RS07220 1564500..1564592 - 93 WP_079386045.1 DUF3265 domain-containing protein -
PWW27_RS07225 1564607..1565542 - 936 WP_025628297.1 nucleoside 2-deoxyribosyltransferase -
PWW27_RS07230 1565623..1565685 - 63 Protein_1403 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1522282..1580952 58670
- inside Integron - - 1530652..1580952 50300


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10891.57 Da        Isoelectric Point: 4.3430

>T273244 WP_005398411.1 NZ_CP118576:1560589-1560867 [Vibrio harveyi]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11069.40 Da        Isoelectric Point: 9.2167

>AT273244 WP_005398409.1 NZ_CP118576:1560308-1560592 [Vibrio harveyi]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR22

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR21

References