Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 257490..258016 | Replicon | plasmid unnamed1 |
Accession | NZ_CP118568 | ||
Organism | Enterobacter hormaechei strain 2020CK-00199 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | PXV21_RS24130 | Protein ID | WP_000323025.1 |
Coordinates | 257490..257777 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | PXV21_RS24135 | Protein ID | WP_000534858.1 |
Coordinates | 257777..258016 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXV21_RS24095 (PXV21_24095) | 253060..253236 | - | 177 | WP_001371930.1 | hypothetical protein | - |
PXV21_RS24100 (PXV21_24100) | 253747..254691 | + | 945 | WP_000778029.1 | DUF5417 domain-containing protein | - |
PXV21_RS24105 (PXV21_24105) | 254787..255389 | + | 603 | WP_012695474.1 | hypothetical protein | - |
PXV21_RS24110 (PXV21_24110) | 255449..255799 | + | 351 | WP_000743059.1 | hypothetical protein | - |
PXV21_RS24115 (PXV21_24115) | 255846..256049 | + | 204 | WP_001015183.1 | hypothetical protein | - |
PXV21_RS24120 (PXV21_24120) | 256331..256651 | + | 321 | WP_000332796.1 | hypothetical protein | - |
PXV21_RS24125 (PXV21_24125) | 257264..257389 | - | 126 | WP_229020258.1 | DUF5431 family protein | - |
PXV21_RS24130 (PXV21_24130) | 257490..257777 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
PXV21_RS24135 (PXV21_24135) | 257777..258016 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
PXV21_RS24140 (PXV21_24140) | 258041..258145 | + | 105 | Protein_270 | protein YdfV | - |
PXV21_RS24145 (PXV21_24145) | 258279..259202 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
PXV21_RS24150 (PXV21_24150) | 259402..259974 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
PXV21_RS24155 (PXV21_24155) | 260450..261688 | - | 1239 | WP_000219087.1 | IS110-like element ISEsa2 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaKPC-4 / blaTEM-1A / aph(3')-Ia / mph(A) / sul1 / qacE / aadA17 / ant(2'')-Ia / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / formA / mcr-9 | - | 1..315525 | 315525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T273242 WP_000323025.1 NZ_CP118568:c257777-257490 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|