Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3520854..3521593 | Replicon | chromosome |
| Accession | NZ_CP118567 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00199 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A431SEP0 |
| Locus tag | PXV21_RS16830 | Protein ID | WP_022649088.1 |
| Coordinates | 3521213..3521593 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A431SER1 |
| Locus tag | PXV21_RS16825 | Protein ID | WP_022649087.1 |
| Coordinates | 3520854..3521180 (+) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXV21_RS16810 (PXV21_16810) | 3516748..3519408 | - | 2661 | WP_022649084.1 | antiviral RADAR system adenosine triphosphatase RdrA | - |
| PXV21_RS16815 (PXV21_16815) | 3520038..3520361 | + | 324 | WP_022649085.1 | antirestriction protein | - |
| PXV21_RS16820 (PXV21_16820) | 3520376..3520843 | + | 468 | WP_022649086.1 | DNA repair protein RadC | - |
| PXV21_RS16825 (PXV21_16825) | 3520854..3521180 | + | 327 | WP_022649087.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PXV21_RS16830 (PXV21_16830) | 3521213..3521593 | + | 381 | WP_022649088.1 | TA system toxin CbtA family protein | Toxin |
| PXV21_RS16835 (PXV21_16835) | 3521590..3521817 | + | 228 | WP_022649089.1 | DUF5983 family protein | - |
| PXV21_RS16840 (PXV21_16840) | 3522209..3522502 | + | 294 | WP_022649090.1 | contact-dependent growth inhibition system immunity protein | - |
| PXV21_RS16845 (PXV21_16845) | 3522846..3524162 | - | 1317 | WP_022649091.1 | amidase family protein | - |
| PXV21_RS16850 (PXV21_16850) | 3524217..3525512 | - | 1296 | WP_022649092.1 | histidinol dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3497745..3522502 | 24757 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13850.66 Da Isoelectric Point: 5.8788
>T273238 WP_022649088.1 NZ_CP118567:3521213-3521593 [Enterobacter hormaechei]
MQTLPLPEPRAAEPCPSPVQVWQLLLTHLLDKHYGLTLNDTPFGDDGVIQAHINAGISLCDAVNFIVERYELLRTDHSSS
SLTEHSSLIGAIDILRAHRATGLIVGSGYSTITRITTGQYREDKTQ
MQTLPLPEPRAAEPCPSPVQVWQLLLTHLLDKHYGLTLNDTPFGDDGVIQAHINAGISLCDAVNFIVERYELLRTDHSSS
SLTEHSSLIGAIDILRAHRATGLIVGSGYSTITRITTGQYREDKTQ
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A431SEP0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A431SER1 |