Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2226725..2227464 | Replicon | chromosome |
| Accession | NZ_CP118567 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00199 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A3S0FZ61 |
| Locus tag | PXV21_RS10600 | Protein ID | WP_022648141.1 |
| Coordinates | 2226725..2227210 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | PXV21_RS10605 | Protein ID | WP_003857131.1 |
| Coordinates | 2227198..2227464 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXV21_RS10575 (PXV21_10575) | 2222881..2223903 | + | 1023 | WP_022648135.1 | alpha/beta hydrolase | - |
| PXV21_RS10580 (PXV21_10580) | 2223999..2224763 | + | 765 | WP_022648136.1 | SDR family oxidoreductase | - |
| PXV21_RS10585 (PXV21_10585) | 2225430..2225693 | + | 264 | WP_022648138.1 | DUF4225 domain-containing protein | - |
| PXV21_RS10590 (PXV21_10590) | 2225668..2225997 | - | 330 | WP_022648139.1 | hypothetical protein | - |
| PXV21_RS10595 (PXV21_10595) | 2226130..2226699 | + | 570 | WP_022648140.1 | hypothetical protein | - |
| PXV21_RS10600 (PXV21_10600) | 2226725..2227210 | - | 486 | WP_022648141.1 | GNAT family N-acetyltransferase | Toxin |
| PXV21_RS10605 (PXV21_10605) | 2227198..2227464 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| PXV21_RS10610 (PXV21_10610) | 2227528..2228457 | - | 930 | WP_022648142.1 | LysR family transcriptional regulator | - |
| PXV21_RS10615 (PXV21_10615) | 2228587..2229975 | + | 1389 | WP_022648143.1 | MFS transporter | - |
| PXV21_RS10620 (PXV21_10620) | 2229954..2230511 | - | 558 | WP_022648144.1 | OmpH family outer membrane protein | - |
| PXV21_RS10625 (PXV21_10625) | 2230632..2231768 | - | 1137 | WP_022648145.1 | type 1 fimbrial protein | - |
| PXV21_RS10630 (PXV21_10630) | 2231792..2232370 | - | 579 | WP_022648146.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2203858..2227464 | 23606 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17558.24 Da Isoelectric Point: 9.6275
>T273233 WP_022648141.1 NZ_CP118567:c2227210-2226725 [Enterobacter hormaechei]
VGRVTPPEPLSSVHQLAEFISGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSIRGNGLGADLLQDAVLRCYRVAENIGVRAIMVHALTEDAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTPPEPLSSVHQLAEFISGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSIRGNGLGADLLQDAVLRCYRVAENIGVRAIMVHALTEDAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S0FZ61 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FCR9 |