Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1081753..1082374 | Replicon | chromosome |
Accession | NZ_CP118567 | ||
Organism | Enterobacter hormaechei strain 2020CK-00199 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A837FFM2 |
Locus tag | PXV21_RS05150 | Protein ID | WP_015571250.1 |
Coordinates | 1081753..1081971 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | F5RUW7 |
Locus tag | PXV21_RS05155 | Protein ID | WP_006809850.1 |
Coordinates | 1082000..1082374 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXV21_RS05120 (PXV21_05120) | 1077765..1078025 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
PXV21_RS05125 (PXV21_05125) | 1078028..1078168 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
PXV21_RS05130 (PXV21_05130) | 1078165..1078875 | - | 711 | WP_022647267.1 | GNAT family protein | - |
PXV21_RS05135 (PXV21_05135) | 1078978..1080438 | + | 1461 | WP_022647268.1 | PLP-dependent aminotransferase family protein | - |
PXV21_RS05140 (PXV21_05140) | 1080410..1080877 | - | 468 | WP_022647269.1 | YlaC family protein | - |
PXV21_RS05145 (PXV21_05145) | 1080994..1081545 | - | 552 | WP_022647270.1 | maltose O-acetyltransferase | - |
PXV21_RS05150 (PXV21_05150) | 1081753..1081971 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
PXV21_RS05155 (PXV21_05155) | 1082000..1082374 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
PXV21_RS05160 (PXV21_05160) | 1082884..1086030 | - | 3147 | WP_022647271.1 | multidrug efflux RND transporter permease subunit AcrB | - |
PXV21_RS05165 (PXV21_05165) | 1086053..1087246 | - | 1194 | WP_022647272.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T273232 WP_015571250.1 NZ_CP118567:c1081971-1081753 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT273232 WP_006809850.1 NZ_CP118567:c1082374-1082000 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FFM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FGN8 |