Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 3725438..3726014 | Replicon | chromosome |
| Accession | NZ_CP118552 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00206 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A800YKM1 |
| Locus tag | PWP98_RS17775 | Protein ID | WP_015572580.1 |
| Coordinates | 3725727..3726014 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A801DSF4 |
| Locus tag | PWP98_RS17770 | Protein ID | WP_017694570.1 |
| Coordinates | 3725438..3725740 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWP98_RS17750 (PWP98_17750) | 3721735..3722280 | + | 546 | WP_006810254.1 | YfaZ family outer membrane protein | - |
| PWP98_RS17755 (PWP98_17755) | 3722456..3723826 | - | 1371 | WP_047745287.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| PWP98_RS17760 (PWP98_17760) | 3723980..3724732 | + | 753 | WP_047745285.1 | AraC family transcriptional regulator | - |
| PWP98_RS17765 (PWP98_17765) | 3724771..3725409 | + | 639 | WP_047736941.1 | LysE family translocator | - |
| PWP98_RS17770 (PWP98_17770) | 3725438..3725740 | - | 303 | WP_017694570.1 | BrnA antitoxin family protein | Antitoxin |
| PWP98_RS17775 (PWP98_17775) | 3725727..3726014 | - | 288 | WP_015572580.1 | BrnT family toxin | Toxin |
| PWP98_RS17780 (PWP98_17780) | 3726184..3727455 | + | 1272 | WP_047745284.1 | DUF445 domain-containing protein | - |
| PWP98_RS17785 (PWP98_17785) | 3727452..3728528 | - | 1077 | WP_015572578.1 | DUF2955 domain-containing protein | - |
| PWP98_RS17790 (PWP98_17790) | 3728518..3729585 | - | 1068 | WP_116293634.1 | HlyD family secretion protein | - |
| PWP98_RS17795 (PWP98_17795) | 3729582..3730052 | - | 471 | WP_015572576.1 | MarR family transcriptional regulator | - |
| PWP98_RS17800 (PWP98_17800) | 3730202..3730897 | - | 696 | WP_032647138.1 | winged helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11296.81 Da Isoelectric Point: 7.3587
>T273226 WP_015572580.1 NZ_CP118552:c3726014-3725727 [Enterobacter hormaechei]
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|