Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 306759..307407 | Replicon | chromosome |
Accession | NZ_CP118547 | ||
Organism | Stenotrophomonas maltophilia strain HT2 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PWE35_RS01375 | Protein ID | WP_005407702.1 |
Coordinates | 306759..307064 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PWE35_RS01380 | Protein ID | WP_005407703.1 |
Coordinates | 307105..307407 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWE35_RS01350 (PWE35_01350) | 302033..302893 | + | 861 | WP_262101535.1 | SPOR domain-containing protein | - |
PWE35_RS01360 (PWE35_01360) | 303487..304158 | - | 672 | WP_005407700.1 | hypothetical protein | - |
PWE35_RS01365 (PWE35_01365) | 304249..305754 | - | 1506 | WP_005407701.1 | hypothetical protein | - |
PWE35_RS01375 (PWE35_01375) | 306759..307064 | + | 306 | WP_005407702.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PWE35_RS01380 (PWE35_01380) | 307105..307407 | + | 303 | WP_005407703.1 | putative addiction module antidote protein | Antitoxin |
PWE35_RS01385 (PWE35_01385) | 307665..307964 | - | 300 | WP_005407704.1 | hypothetical protein | - |
PWE35_RS01390 (PWE35_01390) | 308045..308452 | - | 408 | WP_043035194.1 | hypothetical protein | - |
PWE35_RS01395 (PWE35_01395) | 309043..309813 | + | 771 | WP_005411960.1 | DUF3011 domain-containing protein | - |
PWE35_RS01400 (PWE35_01400) | 309838..310185 | - | 348 | WP_005411961.1 | hypothetical protein | - |
PWE35_RS01405 (PWE35_01405) | 310316..311236 | + | 921 | WP_005407709.1 | arginase | - |
PWE35_RS01410 (PWE35_01410) | 311397..311534 | + | 138 | WP_005407710.1 | entericidin A/B family lipoprotein | - |
PWE35_RS01415 (PWE35_01415) | 311743..311964 | + | 222 | WP_004153772.1 | CsbD family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11444.15 Da Isoelectric Point: 10.9897
>T273216 WP_005407702.1 NZ_CP118547:306759-307064 [Stenotrophomonas maltophilia]
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAKEIARALRASNWL
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAKEIARALRASNWL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|