Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 200372..201008 | Replicon | chromosome |
| Accession | NZ_CP118545 | ||
| Organism | Priestia aryabhattai strain G5.MM8 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | D5DWT4 |
| Locus tag | PWC21_RS01135 | Protein ID | WP_013055004.1 |
| Coordinates | 200658..201008 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | D5DWT3 |
| Locus tag | PWC21_RS01130 | Protein ID | WP_013055003.1 |
| Coordinates | 200372..200653 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWC21_RS01105 (PWC21_01105) | 195738..196709 | + | 972 | WP_033580801.1 | UV DNA damage repair endonuclease UvsE | - |
| PWC21_RS01110 (PWC21_01110) | 196718..197320 | - | 603 | WP_274863137.1 | rhomboid family intramembrane serine protease | - |
| PWC21_RS01115 (PWC21_01115) | 197385..197750 | + | 366 | WP_028411881.1 | holo-ACP synthase | - |
| PWC21_RS01120 (PWC21_01120) | 197809..198867 | + | 1059 | WP_033580802.1 | outer membrane lipoprotein carrier protein LolA | - |
| PWC21_RS01125 (PWC21_01125) | 198981..200171 | + | 1191 | WP_274863138.1 | alanine racemase | - |
| PWC21_RS01130 (PWC21_01130) | 200372..200653 | + | 282 | WP_013055003.1 | hypothetical protein | Antitoxin |
| PWC21_RS01135 (PWC21_01135) | 200658..201008 | + | 351 | WP_013055004.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| PWC21_RS01140 (PWC21_01140) | 201166..202002 | + | 837 | WP_013055005.1 | RsbT co-antagonist protein RsbRA | - |
| PWC21_RS01145 (PWC21_01145) | 202005..202361 | + | 357 | WP_013055006.1 | STAS domain-containing protein | - |
| PWC21_RS01150 (PWC21_01150) | 202365..202766 | + | 402 | WP_013055007.1 | anti-sigma regulatory factor | - |
| PWC21_RS01155 (PWC21_01155) | 202780..203790 | + | 1011 | WP_013055008.1 | PP2C family protein-serine/threonine phosphatase | - |
| PWC21_RS01160 (PWC21_01160) | 203850..204182 | + | 333 | WP_013055009.1 | anti-sigma factor antagonist | - |
| PWC21_RS01165 (PWC21_01165) | 204179..204664 | + | 486 | WP_025753516.1 | anti-sigma B factor RsbW | - |
| PWC21_RS01170 (PWC21_01170) | 204630..205424 | + | 795 | WP_013055011.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12991.96 Da Isoelectric Point: 4.8781
>T273214 WP_013055004.1 NZ_CP118545:200658-201008 [Priestia aryabhattai]
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|