Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 532011..532664 | Replicon | chromosome |
| Accession | NZ_CP118544 | ||
| Organism | Brevibacillus parabrevis strain BCP-09 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | J2PLP3 |
| Locus tag | PSE45_RS02875 | Protein ID | WP_005830205.1 |
| Coordinates | 532314..532664 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A3M8AYL7 |
| Locus tag | PSE45_RS02870 | Protein ID | WP_025845698.1 |
| Coordinates | 532011..532310 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSE45_RS02850 (PSE45_02850) | 527281..528318 | + | 1038 | WP_122966581.1 | outer membrane lipoprotein-sorting protein | - |
| PSE45_RS02855 (PSE45_02855) | 528517..529965 | + | 1449 | WP_122966580.1 | hypothetical protein | - |
| PSE45_RS02860 (PSE45_02860) | 530187..530627 | + | 441 | WP_122966579.1 | hypothetical protein | - |
| PSE45_RS02865 (PSE45_02865) | 530630..531832 | + | 1203 | WP_173599859.1 | alanine racemase | - |
| PSE45_RS02870 (PSE45_02870) | 532011..532310 | + | 300 | WP_025845698.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PSE45_RS02875 (PSE45_02875) | 532314..532664 | + | 351 | WP_005830205.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PSE45_RS02880 (PSE45_02880) | 532970..533326 | + | 357 | WP_229049930.1 | anti-sigma regulatory factor | - |
| PSE45_RS02885 (PSE45_02885) | 533320..534321 | + | 1002 | WP_122966576.1 | PP2C family protein-serine/threonine phosphatase | - |
| PSE45_RS02890 (PSE45_02890) | 534347..534673 | + | 327 | WP_063229461.1 | anti-sigma factor antagonist | - |
| PSE45_RS02895 (PSE45_02895) | 534673..535167 | + | 495 | WP_122966575.1 | anti-sigma B factor RsbW | - |
| PSE45_RS02900 (PSE45_02900) | 535136..535933 | + | 798 | WP_122966574.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12917.86 Da Isoelectric Point: 4.8435
>T273213 WP_005830205.1 NZ_CP118544:532314-532664 [Brevibacillus parabrevis]
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTYGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVNESLQISLGLIDF
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTYGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVNESLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | J2PLP3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3M8AYL7 |