Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 52838..53363 Replicon plasmid p1
Accession NZ_CP118543
Organism Salmonella sp. CVCC 1806

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag PWA52_RS23125 Protein ID WP_001159863.1
Coordinates 53058..53363 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag PWA52_RS23120 Protein ID WP_000813641.1
Coordinates 52838..53056 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWA52_RS23085 (PWA52_23085) 47865..48578 + 714 WP_000801114.1 hypothetical protein -
PWA52_RS23090 (PWA52_23090) 48703..49287 + 585 WP_024138406.1 hypothetical protein -
PWA52_RS23095 (PWA52_23095) 49360..49572 + 213 WP_000063791.1 FaeA/PapI family transcriptional regulator -
PWA52_RS23100 (PWA52_23100) 49833..49994 + 162 WP_001816720.1 hypothetical protein -
PWA52_RS23105 (PWA52_23105) 50020..50868 + 849 WP_000175397.1 SdiA-regulated domain-containing protein -
PWA52_RS23110 (PWA52_23110) 51438..51866 - 429 WP_001746752.1 type II toxin-antitoxin system VapC family toxin -
PWA52_RS23115 (PWA52_23115) 51863..52093 - 231 WP_001261283.1 type II toxin-antitoxin system VapB family antitoxin -
PWA52_RS23120 (PWA52_23120) 52838..53056 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PWA52_RS23125 (PWA52_23125) 53058..53363 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
PWA52_RS23130 (PWA52_23130) 53365..53655 + 291 WP_001266176.1 hypothetical protein -
PWA52_RS23135 (PWA52_23135) 53652..54173 + 522 WP_000198608.1 hypothetical protein -
PWA52_RS23140 (PWA52_23140) 54208..54990 + 783 WP_000082169.1 site-specific integrase -
PWA52_RS23145 (PWA52_23145) 54999..55550 + 552 WP_079786988.1 EAL domain-containing protein -
PWA52_RS23150 (PWA52_23150) 55737..56225 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
PWA52_RS23155 (PWA52_23155) 56219..56704 + 486 WP_000905606.1 membrane protein -
PWA52_RS23160 (PWA52_23160) 56981..57268 - 288 WP_071530243.1 hypothetical protein -
PWA52_RS23165 (PWA52_23165) 57424..57984 + 561 WP_071785580.1 inverse autotransporter beta domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - faeH / faeI / fdeC / spvC / spvB 1..86351 86351


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T273212 WP_001159863.1 NZ_CP118543:53058-53363 [Salmonella sp. CVCC 1806]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT273212 WP_000813641.1 NZ_CP118543:52838-53056 [Salmonella sp. CVCC 1806]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References