Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4193134..4193915 | Replicon | chromosome |
| Accession | NZ_CP118542 | ||
| Organism | Salmonella sp. CVCC 1806 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | B5R980 |
| Locus tag | PWA52_RS20490 | Protein ID | WP_000626100.1 |
| Coordinates | 4193134..4193625 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | PWA52_RS20495 | Protein ID | WP_001110452.1 |
| Coordinates | 4193622..4193915 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWA52_RS20455 (4188594) | 4188594..4188941 | + | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
| PWA52_RS20460 (4188917) | 4188917..4190620 | + | 1704 | WP_079786765.1 | protein-disulfide reductase DsbD | - |
| PWA52_RS20465 (4190657) | 4190657..4191232 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
| PWA52_RS20475 (4191503) | 4191503..4191577 | - | 75 | Protein_4014 | helix-turn-helix domain-containing protein | - |
| PWA52_RS20480 (4191957) | 4191957..4192034 | + | 78 | Protein_4015 | porin family protein | - |
| PWA52_RS20485 (4192134) | 4192134..4192886 | + | 753 | WP_000842432.1 | non-specific acid phosphatase | - |
| PWA52_RS20490 (4193134) | 4193134..4193625 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
| PWA52_RS20495 (4193622) | 4193622..4193915 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| PWA52_RS20500 (4194232) | 4194232..4194453 | + | 222 | WP_001576552.1 | hypothetical protein | - |
| PWA52_RS20505 (4194718) | 4194718..4195593 | + | 876 | WP_000921680.1 | AraC family transcriptional regulator | - |
| PWA52_RS20510 (4195590) | 4195590..4195877 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
| PWA52_RS20515 (4195870) | 4195870..4196178 | - | 309 | WP_072095651.1 | ABC transporter ATP-binding protein | - |
| PWA52_RS20520 (4196177) | 4196177..4196425 | + | 249 | Protein_4023 | Ig-like domain-containing protein | - |
| PWA52_RS20525 (4196537) | 4196537..4196668 | + | 132 | Protein_4024 | hypothetical protein | - |
| PWA52_RS20530 (4196958) | 4196958..4197860 | - | 903 | WP_020937303.1 | YjiK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T273208 WP_000626100.1 NZ_CP118542:c4193625-4193134 [Salmonella sp. CVCC 1806]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656IQ80 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |