Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4086230..4086746 | Replicon | chromosome |
| Accession | NZ_CP118542 | ||
| Organism | Salmonella sp. CVCC 1806 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A756PF38 |
| Locus tag | PWA52_RS19915 | Protein ID | WP_000220583.1 |
| Coordinates | 4086230..4086514 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PWA52_RS19920 | Protein ID | WP_000212724.1 |
| Coordinates | 4086504..4086746 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWA52_RS19900 (4081445) | 4081445..4083093 | + | 1649 | Protein_3903 | alpha,alpha-phosphotrehalase | - |
| PWA52_RS19905 (4083502) | 4083502..4085640 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PWA52_RS19910 (4085762) | 4085762..4086226 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PWA52_RS19915 (4086230) | 4086230..4086514 | - | 285 | WP_000220583.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PWA52_RS19920 (4086504) | 4086504..4086746 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PWA52_RS19925 (4086824) | 4086824..4088737 | - | 1914 | WP_001212128.1 | BglG family transcription antiterminator | - |
| PWA52_RS19930 (4088754) | 4088754..4089494 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
| PWA52_RS19935 (4089491) | 4089491..4090609 | - | 1119 | WP_269724545.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PWA52_RS19940 (4090593) | 4090593..4091726 | - | 1134 | WP_000459957.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10896.62 Da Isoelectric Point: 9.6743
>T273207 WP_000220583.1 NZ_CP118542:c4086514-4086230 [Salmonella sp. CVCC 1806]
MTYELEFDPRALKEWHKLGDTVQAQLKKKLADVLLNPRIDSARLNDPPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVQAQLKKKLADVLLNPRIDSARLNDPPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A756PF38 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |