Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4047158..4047708 Replicon chromosome
Accession NZ_CP118542
Organism Salmonella sp. CVCC 1806

Toxin (Protein)


Gene name ccdB Uniprot ID A0A764IVN5
Locus tag PWA52_RS19715 Protein ID WP_001199742.1
Coordinates 4047158..4047466 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag PWA52_RS19720 Protein ID WP_001118105.1
Coordinates 4047469..4047708 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWA52_RS19695 (4043733) 4043733..4044473 - 741 WP_001575372.1 SEF14/SEF18 fimbria chaperone SefB -
PWA52_RS19700 (4044595) 4044595..4045125 - 531 WP_000909461.1 SEF14 fimbria major subunit SefA -
PWA52_RS19705 (4045447) 4045447..4046580 + 1134 Protein_3865 IS3 family transposase -
PWA52_RS19710 (4046612) 4046612..4046752 - 141 Protein_3866 Arm DNA-binding domain-containing protein -
PWA52_RS19715 (4047158) 4047158..4047466 - 309 WP_001199742.1 CcdB family protein Toxin
PWA52_RS19720 (4047469) 4047469..4047708 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PWA52_RS19725 (4047817) 4047817..4048065 - 249 WP_000168388.1 ribbon-helix-helix domain-containing protein -
PWA52_RS19730 (4048256) 4048256..4048687 - 432 Protein_3870 helix-turn-helix domain-containing protein -
PWA52_RS19740 (4049444) 4049444..4050463 + 1020 WP_000152558.1 NAD(P)-dependent alcohol dehydrogenase -
PWA52_RS19745 (4050491) 4050491..4051021 - 531 WP_000896758.1 gluconokinase -
PWA52_RS19750 (4051238) 4051238..4052269 + 1032 WP_000453347.1 L-idonate 5-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4027751..4047708 19957
- inside IScluster/Tn - - 4045539..4048642 3103
- inside Genomic island - - 4027751..4048065 20314


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11826.62 Da        Isoelectric Point: 6.4785

>T273206 WP_001199742.1 NZ_CP118542:c4047466-4047158 [Salmonella sp. CVCC 1806]
MQYMVYHNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT273206 WP_001118105.1 NZ_CP118542:c4047708-4047469 [Salmonella sp. CVCC 1806]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A764IVN5

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References