Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4001480..4002056 | Replicon | chromosome |
| Accession | NZ_CP118542 | ||
| Organism | Salmonella sp. CVCC 1806 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | M7RG88 |
| Locus tag | PWA52_RS19490 | Protein ID | WP_001131963.1 |
| Coordinates | 4001769..4002056 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | B5R9R5 |
| Locus tag | PWA52_RS19485 | Protein ID | WP_000063142.1 |
| Coordinates | 4001480..4001782 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWA52_RS19470 (3998434) | 3998434..4000122 | + | 1689 | Protein_3818 | pyruvate/proton symporter BtsT | - |
| PWA52_RS19475 (4000235) | 4000235..4000438 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| PWA52_RS19480 (4000449) | 4000449..4001405 | + | 957 | WP_000187842.1 | GTPase | - |
| PWA52_RS19485 (4001480) | 4001480..4001782 | - | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
| PWA52_RS19490 (4001769) | 4001769..4002056 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
| PWA52_RS19495 (4002452) | 4002452..4004292 | + | 1841 | Protein_3823 | 3'-5' exonuclease | - |
| PWA52_RS19500 (4004905) | 4004905..4005324 | + | 420 | WP_001720162.1 | restriction endonuclease subunit S | - |
| PWA52_RS19505 (4005483) | 4005483..4006736 | + | 1254 | WP_001206756.1 | N-6 DNA methylase | - |
| PWA52_RS19510 (4006768) | 4006768..4006902 | - | 135 | WP_001055725.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T273205 WP_001131963.1 NZ_CP118542:c4002056-4001769 [Salmonella sp. CVCC 1806]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7VD7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7VD7 | |
| AlphaFold DB | A0A4D6PB01 |