Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3367261..3367881 | Replicon | chromosome |
| Accession | NZ_CP118542 | ||
| Organism | Salmonella sp. CVCC 1806 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PWA52_RS16380 | Protein ID | WP_001280991.1 |
| Coordinates | 3367663..3367881 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A6C6Z3Y6 |
| Locus tag | PWA52_RS16375 | Protein ID | WP_000344806.1 |
| Coordinates | 3367261..3367635 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWA52_RS16365 (3362400) | 3362400..3363593 | + | 1194 | WP_020937096.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PWA52_RS16370 (3363616) | 3363616..3366765 | + | 3150 | WP_020937097.1 | efflux RND transporter permease AcrB | - |
| PWA52_RS16375 (3367261) | 3367261..3367635 | + | 375 | WP_000344806.1 | Hha toxicity modulator TomB | Antitoxin |
| PWA52_RS16380 (3367663) | 3367663..3367881 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PWA52_RS16385 (3368060) | 3368060..3368611 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| PWA52_RS16390 (3368729) | 3368729..3369199 | + | 471 | WP_079786716.1 | YlaC family protein | - |
| PWA52_RS16395 (3369255) | 3369255..3369395 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| PWA52_RS16400 (3369397) | 3369397..3369663 | - | 267 | WP_020937098.1 | type B 50S ribosomal protein L31 | - |
| PWA52_RS16405 (3369888) | 3369888..3371438 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| PWA52_RS16415 (3371669) | 3371669..3372058 | + | 390 | WP_000961288.1 | MGMT family protein | - |
| PWA52_RS16420 (3372091) | 3372091..3372660 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T273202 WP_001280991.1 NZ_CP118542:3367663-3367881 [Salmonella sp. CVCC 1806]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14425.25 Da Isoelectric Point: 5.1444
>AT273202 WP_000344806.1 NZ_CP118542:3367261-3367635 [Salmonella sp. CVCC 1806]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATKANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATKANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|