Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 983187..984001 | Replicon | chromosome |
| Accession | NZ_CP118542 | ||
| Organism | Salmonella sp. CVCC 1806 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | B5RDM7 |
| Locus tag | PWA52_RS04730 | Protein ID | WP_000971654.1 |
| Coordinates | 983187..983714 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | PWA52_RS04735 | Protein ID | WP_000855694.1 |
| Coordinates | 983711..984001 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWA52_RS04705 (979476) | 979476..979874 | + | 399 | Protein_921 | cytoplasmic protein | - |
| PWA52_RS04710 (980460) | 980460..981128 | + | 669 | WP_000445914.1 | hypothetical protein | - |
| PWA52_RS04715 (981155) | 981155..981649 | + | 495 | WP_000424949.1 | hypothetical protein | - |
| PWA52_RS04720 (981894) | 981894..982550 | - | 657 | WP_000420455.1 | protein-serine/threonine phosphatase | - |
| PWA52_RS04725 (982909) | 982909..983114 | + | 206 | Protein_925 | IS5/IS1182 family transposase | - |
| PWA52_RS04730 (983187) | 983187..983714 | - | 528 | WP_000971654.1 | GNAT family N-acetyltransferase | Toxin |
| PWA52_RS04735 (983711) | 983711..984001 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| PWA52_RS04740 (984271) | 984271..984460 | - | 190 | Protein_928 | IS3 family transposase | - |
| PWA52_RS04745 (984864) | 984864..985307 | - | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| PWA52_RS04750 (985763) | 985763..986413 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
| PWA52_RS04755 (986410) | 986410..988098 | + | 1689 | WP_000848115.1 | type III secretion system outer membrane ring protein InvG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 982938..983114 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19041.85 Da Isoelectric Point: 9.6420
>T273197 WP_000971654.1 NZ_CP118542:c983714-983187 [Salmonella sp. CVCC 1806]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQACDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQACDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Y9PNF0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V8SJE7 |