Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 305889..306475 Replicon chromosome
Accession NZ_CP118542
Organism Salmonella sp. CVCC 1806

Toxin (Protein)


Gene name doc Uniprot ID A0A3V9X0E4
Locus tag PWA52_RS01405 Protein ID WP_000174964.1
Coordinates 306107..306475 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID V7IU48
Locus tag PWA52_RS01400 Protein ID WP_001522145.1
Coordinates 305889..306110 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWA52_RS01375 (300910) 300910..302019 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PWA52_RS01380 (302079) 302079..303005 + 927 WP_079786686.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PWA52_RS01385 (303002) 303002..304279 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PWA52_RS01390 (304276) 304276..305043 + 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PWA52_RS01395 (305045) 305045..305758 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PWA52_RS01400 (305889) 305889..306110 + 222 WP_001522145.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWA52_RS01405 (306107) 306107..306475 + 369 WP_000174964.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PWA52_RS01410 (306734) 306734..308050 + 1317 WP_000624755.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PWA52_RS01415 (308155) 308155..309042 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PWA52_RS01420 (309039) 309039..309884 + 846 WP_000572194.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PWA52_RS01425 (309886) 309886..310956 + 1071 WP_000907835.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 303002..311693 8691
- inside Prophage - - 300910..311693 10783


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-114)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13601.91 Da        Isoelectric Point: 6.7252

>T273193 WP_000174964.1 NZ_CP118542:306107-306475 [Salmonella sp. CVCC 1806]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8166.17 Da        Isoelectric Point: 5.0775

>AT273193 WP_001522145.1 NZ_CP118542:305889-306110 [Salmonella sp. CVCC 1806]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V9X0E4

Antitoxin

Source ID Structure

References