Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1246660..1247577 | Replicon | chromosome |
Accession | NZ_CP118541 | ||
Organism | Bacillus velezensis strain HC-5 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | PWA59_RS06575 | Protein ID | WP_007407256.1 |
Coordinates | 1246831..1247577 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2C3Z8 |
Locus tag | PWA59_RS06570 | Protein ID | WP_014417527.1 |
Coordinates | 1246660..1246830 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWA59_RS06520 (1241866) | 1241866..1242378 | + | 513 | WP_012117362.1 | sigma-70 family RNA polymerase sigma factor | - |
PWA59_RS06525 (1242491) | 1242491..1243042 | + | 552 | Protein_1224 | terminase | - |
PWA59_RS06530 (1243153) | 1243153..1243515 | + | 363 | WP_014721043.1 | hypothetical protein | - |
PWA59_RS06535 (1243528) | 1243528..1243899 | + | 372 | WP_014417525.1 | XkdW family protein | - |
PWA59_RS06540 (1243904) | 1243904..1244101 | + | 198 | WP_007610833.1 | XkdX family protein | - |
PWA59_RS06545 (1244158) | 1244158..1244919 | + | 762 | WP_014417526.1 | hypothetical protein | - |
PWA59_RS06550 (1244971) | 1244971..1245234 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
PWA59_RS06555 (1245248) | 1245248..1245511 | + | 264 | WP_003154813.1 | phage holin | - |
PWA59_RS06560 (1245525) | 1245525..1246403 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
PWA59_RS06565 (1246438) | 1246438..1246563 | - | 126 | WP_003154809.1 | hypothetical protein | - |
PWA59_RS06570 (1246660) | 1246660..1246830 | - | 171 | WP_014417527.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
PWA59_RS06575 (1246831) | 1246831..1247577 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
PWA59_RS06580 (1247681) | 1247681..1248679 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
PWA59_RS06585 (1248692) | 1248692..1249309 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
PWA59_RS06590 (1249595) | 1249595..1250911 | - | 1317 | WP_007610842.1 | amino acid permease | - |
PWA59_RS06595 (1251233) | 1251233..1252183 | + | 951 | WP_014417529.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1232807..1255793 | 22986 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T273191 WP_007407256.1 NZ_CP118541:c1247577-1246831 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|