Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 468211..468848 | Replicon | chromosome |
| Accession | NZ_CP118541 | ||
| Organism | Bacillus velezensis strain HC-5 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | PWA59_RS02410 | Protein ID | WP_003156187.1 |
| Coordinates | 468498..468848 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | PWA59_RS02405 | Protein ID | WP_003156188.1 |
| Coordinates | 468211..468492 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWA59_RS02385 (464576) | 464576..465175 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
| PWA59_RS02390 (465268) | 465268..465633 | + | 366 | WP_014304402.1 | holo-ACP synthase | - |
| PWA59_RS02395 (465798) | 465798..466805 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
| PWA59_RS02400 (466922) | 466922..468091 | + | 1170 | WP_014416966.1 | alanine racemase | - |
| PWA59_RS02405 (468211) | 468211..468492 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| PWA59_RS02410 (468498) | 468498..468848 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| PWA59_RS02415 (468966) | 468966..469787 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
| PWA59_RS02420 (469792) | 469792..470157 | + | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
| PWA59_RS02425 (470160) | 470160..470561 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| PWA59_RS02430 (470573) | 470573..471580 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
| PWA59_RS02435 (471644) | 471644..471973 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| PWA59_RS02440 (471970) | 471970..472452 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
| PWA59_RS02445 (472418) | 472418..473206 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
| PWA59_RS02450 (473206) | 473206..473808 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T273190 WP_003156187.1 NZ_CP118541:468498-468848 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|