Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) shpAB/BrnT-BrnA
Location 35845..36427 Replicon plasmid pXF879-41
Accession NZ_CP118540
Organism Xylella fastidiosa strain ICMP 15197

Toxin (Protein)


Gene name shpA Uniprot ID A0A060HA48
Locus tag PXH81_RS11785 Protein ID WP_038229226.1
Coordinates 36137..36427 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name shpB Uniprot ID A0A060HE88
Locus tag PXH81_RS11780 Protein ID WP_004091409.1
Coordinates 35845..36150 (-) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXH81_RS11750 (PXH81_11750) 32394..32819 + 426 WP_004091423.1 antirestriction protein -
PXH81_RS11755 (PXH81_11755) 33087..33344 + 258 WP_038229233.1 hypothetical protein -
PXH81_RS11760 (PXH81_11760) 33538..34170 - 633 WP_004091419.1 YkgJ family cysteine cluster protein -
PXH81_RS11765 (PXH81_11765) 34291..34848 - 558 WP_004091417.1 recombinase family protein -
PXH81_RS11770 (PXH81_11770) 35038..35412 - 375 WP_010894485.1 DUF5615 family PIN-like protein -
PXH81_RS11775 (PXH81_11775) 35409..35639 - 231 WP_004091411.1 DUF433 domain-containing protein -
PXH81_RS11780 (PXH81_11780) 35845..36150 - 306 WP_004091409.1 BrnA antitoxin family protein Antitoxin
PXH81_RS11785 (PXH81_11785) 36137..36427 - 291 WP_038229226.1 BrnT family toxin Toxin
PXH81_RS11790 (PXH81_11790) 36604..36777 + 174 Protein_41 XRE family transcriptional regulator -
PXH81_RS11795 (PXH81_11795) 36888..37208 + 321 WP_004091397.1 type II toxin-antitoxin system RelE/ParE family toxin -
PXH81_RS11800 (PXH81_11800) 37338..37664 + 327 WP_004091396.1 DNA-binding protein -
PXH81_RS11805 (PXH81_11805) 37806..38732 - 927 WP_051606204.1 hypothetical protein -
PXH81_RS11810 (PXH81_11810) 39138..39554 - 417 WP_038232460.1 IS200/IS605 family transposase -
PXH81_RS11815 (PXH81_11815) 39577..40734 + 1158 WP_038232468.1 RNA-guided endonuclease TnpB family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..41752 41752
- inside IScluster/Tn - - 34291..40734 6443


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(7-89)

Antitoxin

BrnA antitoxin of type II toxin-antitoxin system

(11-93)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11304.62 Da        Isoelectric Point: 6.0917

>T273189 WP_038229226.1 NZ_CP118540:c36427-36137 [Xylella fastidiosa]
VERYFEWDDKKAESNFRKHGIRFDEAALAFDDPFAVSEQNRIENGEQRWQTIGMAGGCLLLLVAHTVHFEDDGIEVVRII
SARRVDRKERRRYEHG

Download         Length: 291 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 11684.43 Da        Isoelectric Point: 9.4870

>AT273189 WP_004091409.1 NZ_CP118540:c36150-35845 [Xylella fastidiosa]
MNMVRYKQSELPPLTEERKAELKALAKKPDSEIDYSDIPPLDESFWARAVPNPFFKPVKTHASVRIDSDVLAWLKSQGKG
YQTRMNAILREAMLRSLHQQE

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A060HA48

Antitoxin

Source ID Structure
AlphaFold DB A0A060HE88

References