Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2530444..2531055 | Replicon | chromosome |
| Accession | NZ_CP118539 | ||
| Organism | Xylella fastidiosa strain ICMP 15197 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q879T9 |
| Locus tag | PXH81_RS11475 | Protein ID | WP_011098375.1 |
| Coordinates | 2530756..2531055 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q879U0 |
| Locus tag | PXH81_RS11470 | Protein ID | WP_004085003.1 |
| Coordinates | 2530444..2530752 (-) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXH81_RS11440 (PXH81_11440) | 2527023..2527784 | - | 762 | WP_004090267.1 | Bax inhibitor-1/YccA family protein | - |
| PXH81_RS11465 (PXH81_11465) | 2528976..2530370 | + | 1395 | WP_274849809.1 | hypothetical protein | - |
| PXH81_RS11470 (PXH81_11470) | 2530444..2530752 | - | 309 | WP_004085003.1 | putative addiction module antidote protein | Antitoxin |
| PXH81_RS11475 (PXH81_11475) | 2530756..2531055 | - | 300 | WP_011098375.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PXH81_RS11480 (PXH81_11480) | 2531143..2531688 | + | 546 | WP_011098376.1 | hypothetical protein | - |
| PXH81_RS11485 (PXH81_11485) | 2531700..2531843 | + | 144 | WP_155115087.1 | hypothetical protein | - |
| PXH81_RS11490 (PXH81_11490) | 2531996..2532376 | - | 381 | WP_004089371.1 | DUF596 domain-containing protein | - |
| PXH81_RS11495 (PXH81_11495) | 2532381..2533511 | - | 1131 | WP_012382788.1 | DUF769 domain-containing protein | - |
| PXH81_RS11500 (PXH81_11500) | 2533819..2534199 | - | 381 | WP_004087391.1 | DUF596 domain-containing protein | - |
| PXH81_RS11505 (PXH81_11505) | 2534211..2535572 | - | 1362 | WP_272819646.1 | hemagglutinin | - |
| PXH81_RS11510 (PXH81_11510) | 2535652..2535795 | + | 144 | WP_155115088.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2481278..2531505 | 50227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11378.17 Da Isoelectric Point: 10.3861
>T273188 WP_011098375.1 NZ_CP118539:c2531055-2530756 [Xylella fastidiosa]
MTYTLKRLEGFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDK
STQQSDIRRAIELAKSLED
MTYTLKRLEGFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDK
STQQSDIRRAIELAKSLED
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q879T9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A060HCD4 |