Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 1597039..1597625 Replicon chromosome
Accession NZ_CP118539
Organism Xylella fastidiosa strain ICMP 15197

Toxin (Protein)


Gene name hicA Uniprot ID Q87BV5
Locus tag PXH81_RS07390 Protein ID WP_004089517.1
Coordinates 1597371..1597625 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID B2I6C9
Locus tag PXH81_RS07385 Protein ID WP_004085025.1
Coordinates 1597039..1597374 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXH81_RS07355 (PXH81_07355) 1592637..1593548 - 912 WP_004089529.1 iron-sulfur cluster carrier protein ApbC -
PXH81_RS07360 (PXH81_07360) 1593983..1594756 + 774 WP_004089528.1 3-deoxy-manno-octulosonate cytidylyltransferase -
PXH81_RS07365 (PXH81_07365) 1594753..1595218 + 466 Protein_1434 low molecular weight phosphotyrosine protein phosphatase -
PXH81_RS07370 (PXH81_07370) 1595205..1595918 - 714 WP_011098057.1 site-specific DNA-methyltransferase -
PXH81_RS07375 (PXH81_07375) 1596269..1596550 + 282 WP_011098058.1 type II toxin-antitoxin system RelE/ParE family toxin -
PXH81_RS07380 (PXH81_07380) 1596560..1596859 + 300 WP_004089519.1 HigA family addiction module antitoxin -
PXH81_RS07385 (PXH81_07385) 1597039..1597374 - 336 WP_004085025.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PXH81_RS07390 (PXH81_07390) 1597371..1597625 - 255 WP_004089517.1 type II toxin-antitoxin system HicA family toxin Toxin
PXH81_RS07395 (PXH81_07395) 1597678..1598376 - 699 WP_011098059.1 hypothetical protein -
PXH81_RS07400 (PXH81_07400) 1598505..1598966 - 462 WP_011098060.1 hypothetical protein -
PXH81_RS07405 (PXH81_07405) 1598963..1599652 - 690 WP_011098061.1 hypothetical protein -
PXH81_RS07410 (PXH81_07410) 1599633..1600739 - 1107 WP_012382665.1 YdaU family protein -
PXH81_RS07415 (PXH81_07415) 1600736..1600981 - 246 WP_225621698.1 hypothetical protein -
PXH81_RS07420 (PXH81_07420) 1601137..1601511 + 375 WP_040123200.1 hypothetical protein -
PXH81_RS07425 (PXH81_07425) 1601517..1602122 + 606 WP_004091108.1 conjugal transfer protein TrbN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(23-80)

Antitoxin

Uncharacterised protein family HicB

(55-105)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9639.14 Da        Isoelectric Point: 11.2766

>T273187 WP_004089517.1 NZ_CP118539:c1597625-1597371 [Xylella fastidiosa]
MKRKHAKTLSAIYTRPVSANIQWRDIEALFVELGAKVEEREGSRMLVRLFGERRIFHRPHPSPNTDKGAVESIRAWLKSN
GVTP

Download         Length: 255 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12324.07 Da        Isoelectric Point: 5.6556

>AT273187 WP_004085025.1 NZ_CP118539:c1597374-1597039 [Xylella fastidiosa]
MKNIMTIESFKAIITYDPEIDMFRGEFVGINGGADFYAKDLKGLRREGAISLKVFLEACKEDSVEPRKCYSGKFNARISP
ELHALASEAAAAQGISLNQFVEQAIQHEVHT

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87BV5

Antitoxin

Source ID Structure
AlphaFold DB A0A060HAK5

References