273185

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) FicTA/Fic(toxin)
Location 1227556..1228352 Replicon chromosome
Accession NZ_CP118539
Organism Xylella fastidiosa strain ICMP 15197

Toxin (Protein)


Gene name VbhT Uniprot ID Q87CQ8
Locus tag PXH81_RS05505 Protein ID WP_004088112.1
Coordinates 1227556..1228167 (-) Length 204 a.a.

Antitoxin (Protein)


Gene name VbhA Uniprot ID B2I551
Locus tag PXH81_RS05510 Protein ID WP_004088114.1
Coordinates 1228164..1228352 (-) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXH81_RS05460 (PXH81_05460) 1223011..1223898 - 888 WP_012382597.1 YdaU family protein -
PXH81_RS05465 (PXH81_05465) 1223895..1224683 - 789 WP_011097897.1 Bro-N domain-containing protein -
PXH81_RS05470 (PXH81_05470) 1224680..1225312 - 633 WP_004088094.1 Bro-N domain-containing protein -
PXH81_RS05475 (PXH81_05475) 1225309..1225572 - 264 WP_228446177.1 hypothetical protein -
PXH81_RS05480 (PXH81_05480) 1225590..1225805 - 216 WP_012382598.1 hypothetical protein -
PXH81_RS05485 (PXH81_05485) 1225835..1226023 - 189 WP_004088102.1 hypothetical protein -
PXH81_RS05490 (PXH81_05490) 1226051..1226242 - 192 WP_004088104.1 hypothetical protein -
PXH81_RS05495 (PXH81_05495) 1226501..1226746 - 246 WP_004088108.1 hypothetical protein -
PXH81_RS05500 (PXH81_05500) 1226831..1227505 + 675 WP_004088110.1 helix-turn-helix transcriptional regulator -
PXH81_RS05505 (PXH81_05505) 1227556..1228167 - 612 WP_004088112.1 Fic/DOC family protein Toxin
PXH81_RS05510 (PXH81_05510) 1228164..1228352 - 189 WP_004088114.1 antitoxin VbhA family protein Antitoxin
PXH81_RS05515 (PXH81_05515) 1228744..1229280 + 537 WP_038233020.1 hypothetical protein -
PXH81_RS05520 (PXH81_05520) 1229277..1229690 + 414 WP_004088056.1 DUF1566 domain-containing protein -
PXH81_RS05525 (PXH81_05525) 1229687..1230088 + 402 WP_004088054.1 hypothetical protein -
PXH81_RS05530 (PXH81_05530) 1230085..1230234 + 150 WP_012382602.1 hypothetical protein -
PXH81_RS05535 (PXH81_05535) 1230452..1230598 + 147 WP_225621633.1 hypothetical protein -
PXH81_RS05540 (PXH81_05540) 1230621..1230812 + 192 WP_012382603.1 hypothetical protein -
PXH81_RS05545 (PXH81_05545) 1230833..1231177 + 345 WP_004088346.1 hypothetical protein -
PXH81_RS05550 (PXH81_05550) 1231217..1232038 + 822 WP_004088345.1 DUF2303 family protein -
PXH81_RS05555 (PXH81_05555) 1232054..1232980 + 927 WP_004088344.1 phage recombination protein Bet -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1197384..1238102 40718


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(55-152)

Antitoxin

Antitoxin VbhA

(10-56)


Sequences

Toxin        


Download         Length: 204 a.a.        Molecular weight: 22832.60 Da        Isoelectric Point: 5.1271

>T273185 WP_004088112.1 NZ_CP118539:c1228167-1227556 [Xylella fastidiosa]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGGLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKERFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIREGISDQLFKDNE

Download         Length: 612 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 6837.77 Da        Isoelectric Point: 4.9859

>AT273185 WP_004088114.1 NZ_CP118539:c1228352-1228164 [Xylella fastidiosa]
MLTDHEKAERRAVVQSALASQRIEGLEPDAQAVVDAECWARGEMTIAAAVDQYKARVRLQIA

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87CQ8

Antitoxin

Source ID Structure
AlphaFold DB B2I551

References