273184

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 1203971..1204448 Replicon chromosome
Accession NZ_CP118539
Organism Xylella fastidiosa strain ICMP 15197

Toxin (Protein)


Gene name pasB Uniprot ID Q87CA4
Locus tag PXH81_RS05315 Protein ID WP_011097988.1
Coordinates 1204182..1204448 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A7G7TPD2
Locus tag PXH81_RS05310 Protein ID WP_004091377.1
Coordinates 1203971..1204198 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXH81_RS05265 (PXH81_05265) 1199108..1199308 - 201 WP_236641891.1 hypothetical protein -
PXH81_RS05270 (PXH81_05270) 1199359..1200243 - 885 WP_236641892.1 baseplate J/gp47 family protein -
PXH81_RS05275 (PXH81_05275) 1200342..1200638 + 297 WP_004089252.1 type II toxin-antitoxin system RelE/ParE family toxin -
PXH81_RS05280 (PXH81_05280) 1200642..1200947 + 306 WP_004089254.1 putative addiction module antidote protein -
PXH81_RS05285 (PXH81_05285) 1200958..1201311 - 354 WP_011097986.1 hypothetical protein -
PXH81_RS05290 (PXH81_05290) 1201308..1201949 - 642 WP_004090764.1 Gp138 family membrane-puncturing spike protein -
PXH81_RS05295 (PXH81_05295) 1201946..1202776 - 831 WP_004090766.1 hypothetical protein -
PXH81_RS05300 (PXH81_05300) 1202773..1203090 - 318 WP_011097873.1 hypothetical protein -
PXH81_RS05305 (PXH81_05305) 1203090..1203860 - 771 WP_004090769.1 hypothetical protein -
PXH81_RS05310 (PXH81_05310) 1203971..1204198 + 228 WP_004091377.1 DUF6290 family protein Antitoxin
PXH81_RS05315 (PXH81_05315) 1204182..1204448 + 267 WP_011097988.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PXH81_RS05320 (PXH81_05320) 1204459..1206054 - 1596 WP_236641893.1 phage tail tape measure protein -
PXH81_RS05325 (PXH81_05325) 1206059..1206358 - 300 WP_159241646.1 hypothetical protein -
PXH81_RS05330 (PXH81_05330) 1206506..1206928 - 423 WP_012382587.1 putative phage tail assembly chaperone -
PXH81_RS05335 (PXH81_05335) 1206968..1207360 - 393 WP_274849827.1 DUF3277 family protein -
PXH81_RS05340 (PXH81_05340) 1207370..1208866 - 1497 WP_038232978.1 DUF3383 domain-containing protein -
PXH81_RS05345 (PXH81_05345) 1208867..1209370 - 504 WP_228762674.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1197384..1238102 40718


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10163.79 Da        Isoelectric Point: 10.6086

>T273184 WP_011097988.1 NZ_CP118539:1204182-1204448 [Xylella fastidiosa]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYR

Download         Length: 267 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8615.63 Da        Isoelectric Point: 5.0958

>AT273184 WP_004091377.1 NZ_CP118539:1203971-1204198 [Xylella fastidiosa]
MATSIRLSPEMEQRLNSLASHTGRTKAYYLREIIEHGIEEMEDYYLAADVLERVRHGQEQVHSAADVRKTLGLDD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A060HDH1

Antitoxin

Source ID Structure
AlphaFold DB A0A7G7TPD2

References