Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/COG3657-DUF971 |
| Location | 1200342..1200947 | Replicon | chromosome |
| Accession | NZ_CP118539 | ||
| Organism | Xylella fastidiosa strain ICMP 15197 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | B2I5N3 |
| Locus tag | PXH81_RS05275 | Protein ID | WP_004089252.1 |
| Coordinates | 1200342..1200638 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PXH81_RS05280 | Protein ID | WP_004089254.1 |
| Coordinates | 1200642..1200947 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXH81_RS05245 (PXH81_05245) | 1195509..1196513 | - | 1005 | WP_072866373.1 | peptidase | - |
| PXH81_RS05250 (PXH81_05250) | 1196673..1196870 | - | 198 | WP_012382581.1 | hypothetical protein | - |
| PXH81_RS05255 (PXH81_05255) | 1197384..1198547 | - | 1164 | WP_038232954.1 | tail fiber protein | - |
| PXH81_RS05260 (PXH81_05260) | 1198551..1199111 | - | 561 | WP_014607744.1 | DUF2612 domain-containing protein | - |
| PXH81_RS05265 (PXH81_05265) | 1199108..1199308 | - | 201 | WP_236641891.1 | hypothetical protein | - |
| PXH81_RS05270 (PXH81_05270) | 1199359..1200243 | - | 885 | WP_236641892.1 | baseplate J/gp47 family protein | - |
| PXH81_RS05275 (PXH81_05275) | 1200342..1200638 | + | 297 | WP_004089252.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PXH81_RS05280 (PXH81_05280) | 1200642..1200947 | + | 306 | WP_004089254.1 | putative addiction module antidote protein | Antitoxin |
| PXH81_RS05285 (PXH81_05285) | 1200958..1201311 | - | 354 | WP_011097986.1 | hypothetical protein | - |
| PXH81_RS05290 (PXH81_05290) | 1201308..1201949 | - | 642 | WP_004090764.1 | Gp138 family membrane-puncturing spike protein | - |
| PXH81_RS05295 (PXH81_05295) | 1201946..1202776 | - | 831 | WP_004090766.1 | hypothetical protein | - |
| PXH81_RS05300 (PXH81_05300) | 1202773..1203090 | - | 318 | WP_011097873.1 | hypothetical protein | - |
| PXH81_RS05305 (PXH81_05305) | 1203090..1203860 | - | 771 | WP_004090769.1 | hypothetical protein | - |
| PXH81_RS05310 (PXH81_05310) | 1203971..1204198 | + | 228 | WP_004091377.1 | DUF6290 family protein | - |
| PXH81_RS05315 (PXH81_05315) | 1204182..1204448 | + | 267 | WP_011097988.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1197384..1238102 | 40718 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10790.57 Da Isoelectric Point: 10.0509
>T273183 WP_004089252.1 NZ_CP118539:1200342-1200638 [Xylella fastidiosa]
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQVRDIEQAKALAALWKD
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQVRDIEQAKALAALWKD
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|