Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/COG3657-DUF971
Location 1200342..1200947 Replicon chromosome
Accession NZ_CP118539
Organism Xylella fastidiosa strain ICMP 15197

Toxin (Protein)


Gene name PumA Uniprot ID B2I5N3
Locus tag PXH81_RS05275 Protein ID WP_004089252.1
Coordinates 1200342..1200638 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PXH81_RS05280 Protein ID WP_004089254.1
Coordinates 1200642..1200947 (+) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXH81_RS05245 (PXH81_05245) 1195509..1196513 - 1005 WP_072866373.1 peptidase -
PXH81_RS05250 (PXH81_05250) 1196673..1196870 - 198 WP_012382581.1 hypothetical protein -
PXH81_RS05255 (PXH81_05255) 1197384..1198547 - 1164 WP_038232954.1 tail fiber protein -
PXH81_RS05260 (PXH81_05260) 1198551..1199111 - 561 WP_014607744.1 DUF2612 domain-containing protein -
PXH81_RS05265 (PXH81_05265) 1199108..1199308 - 201 WP_236641891.1 hypothetical protein -
PXH81_RS05270 (PXH81_05270) 1199359..1200243 - 885 WP_236641892.1 baseplate J/gp47 family protein -
PXH81_RS05275 (PXH81_05275) 1200342..1200638 + 297 WP_004089252.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PXH81_RS05280 (PXH81_05280) 1200642..1200947 + 306 WP_004089254.1 putative addiction module antidote protein Antitoxin
PXH81_RS05285 (PXH81_05285) 1200958..1201311 - 354 WP_011097986.1 hypothetical protein -
PXH81_RS05290 (PXH81_05290) 1201308..1201949 - 642 WP_004090764.1 Gp138 family membrane-puncturing spike protein -
PXH81_RS05295 (PXH81_05295) 1201946..1202776 - 831 WP_004090766.1 hypothetical protein -
PXH81_RS05300 (PXH81_05300) 1202773..1203090 - 318 WP_011097873.1 hypothetical protein -
PXH81_RS05305 (PXH81_05305) 1203090..1203860 - 771 WP_004090769.1 hypothetical protein -
PXH81_RS05310 (PXH81_05310) 1203971..1204198 + 228 WP_004091377.1 DUF6290 family protein -
PXH81_RS05315 (PXH81_05315) 1204182..1204448 + 267 WP_011097988.1 type II toxin-antitoxin system RelE/ParE family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1197384..1238102 40718


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-94)

Antitoxin

Cro/C1-type helix-turn-helix domain

(49-95)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 10790.57 Da        Isoelectric Point: 10.0509

>T273183 WP_004089252.1 NZ_CP118539:1200342-1200638 [Xylella fastidiosa]
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQVRDIEQAKALAALWKD

Download         Length: 297 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 10983.37 Da        Isoelectric Point: 5.0941

>AT273183 WP_004089254.1 NZ_CP118539:1200642-1200947 [Xylella fastidiosa]
MNNETFSRYDTADYLKTEEDIAAYMEAVMEEGGRDNPAFIARALGAVARARNLSQLARDVGMSRQGLDKALSNDGNPSFS
TILKVAKALGLRMSFTPSSMS

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A060HBK9

Antitoxin

Source ID Structure

References