Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mqsR-graA/MqsR-HigA
Location 457557..458222 Replicon chromosome
Accession NZ_CP118539
Organism Xylella fastidiosa strain ICMP 15197

Toxin (Protein)


Gene name mqsR Uniprot ID Q87EE2
Locus tag PXH81_RS01905 Protein ID WP_004090696.1
Coordinates 457920..458222 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name graA Uniprot ID -
Locus tag PXH81_RS01900 Protein ID WP_004085172.1
Coordinates 457557..457832 (+) Length 92 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXH81_RS01870 (PXH81_01870) 453688..454377 - 690 WP_012382453.1 contractile injection system protein, VgrG/Pvc8 family -
PXH81_RS01875 (PXH81_01875) 454307..455278 - 972 WP_011097609.1 hypothetical protein -
PXH81_RS01880 (PXH81_01880) 455286..455843 - 558 WP_011097610.1 phage tail protein I -
PXH81_RS01885 (PXH81_01885) 455836..456729 - 894 WP_274265311.1 baseplate J/gp47 family protein -
PXH81_RS01890 (PXH81_01890) 456729..457091 - 363 WP_014607615.1 GPW/gp25 family protein -
PXH81_RS01895 (PXH81_01895) 457265..457546 + 282 WP_004090695.1 type II toxin-antitoxin system RelE/ParE family toxin -
PXH81_RS01900 (PXH81_01900) 457557..457832 + 276 WP_004085172.1 HigA family addiction module antitoxin Antitoxin
PXH81_RS01905 (PXH81_01905) 457920..458222 + 303 WP_004090696.1 type II toxin-antitoxin system MqsR family toxin Toxin
PXH81_RS01910 (PXH81_01910) 458225..458626 + 402 WP_004090697.1 type II toxin-antitoxin system MqsA family antitoxin -
PXH81_RS01915 (PXH81_01915) 458695..459282 - 588 WP_011097612.1 phage baseplate assembly protein V -
PXH81_RS01920 (PXH81_01920) 459279..459821 - 543 WP_011097613.1 hypothetical protein -
PXH81_RS01925 (PXH81_01925) 459797..460318 - 522 WP_011097614.1 hypothetical protein -
PXH81_RS01930 (PXH81_01930) 460315..460638 - 324 WP_011097935.1 hypothetical protein -
PXH81_RS01935 (PXH81_01935) 460638..460898 - 261 WP_011097616.1 hypothetical protein -
PXH81_RS01940 (PXH81_01940) 460916..462790 - 1875 WP_038232803.1 phage major capsid protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 445863..469776 23913


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin MqsR

(2-99)

Antitoxin

Cro/C1-type helix-turn-helix domain

(15-64)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 10948.71 Da        Isoelectric Point: 8.0251

>T273181 WP_004090696.1 NZ_CP118539:457920-458222 [Xylella fastidiosa]
MEKGTSHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL

Download         Length: 303 bp

Antitoxin


Download         Length: 92 a.a.        Molecular weight: 10072.68 Da        Isoelectric Point: 10.2184

>AT273181 WP_004085172.1 NZ_CP118539:457557-457832 [Xylella fastidiosa]
MKRMHNPAHPGEVLREYLGELTVTNAAAKLGVSRVALSRILNGTNGISADMALRLEDALGTSAEMWAAMQFKYDLWVASQ
QPRPKITRLHV

Download         Length: 276 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87EE2

Antitoxin

Source ID Structure

References