Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 33426..33973 Replicon plasmid p84390bp
Accession NZ_CP118538
Organism Salmonella enterica subsp. enterica serovar Typhi strain S3

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag O1A30_RS23865 Protein ID WP_001384452.1
Coordinates 33426..33704 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A1M1SX19
Locus tag O1A30_RS23870 Protein ID WP_021546940.1
Coordinates 33704..33973 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O1A30_RS23840 (O1A30_23840) 29242..29987 + 746 Protein_30 hypothetical protein -
O1A30_RS23845 (O1A30_23845) 30275..30979 + 705 WP_001067852.1 IS6-like element IS26 family transposase -
O1A30_RS23850 (O1A30_23850) 31034..32584 + 1551 Protein_32 Tn3-like element TnAs1 family transposase -
O1A30_RS23855 (O1A30_23855) 32837..33073 - 237 WP_223417154.1 transposase -
O1A30_RS23860 (O1A30_23860) 33168..33380 - 213 Protein_34 3'-5' exonuclease -
O1A30_RS23865 (O1A30_23865) 33426..33704 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
O1A30_RS23870 (O1A30_23870) 33704..33973 - 270 WP_021546940.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
O1A30_RS23875 (O1A30_23875) 34720..35331 + 612 Protein_37 IS3 family transposase -
O1A30_RS23880 (O1A30_23880) 35363..35542 - 180 WP_012600012.1 hypothetical protein -
O1A30_RS23885 (O1A30_23885) 35766..36083 + 318 WP_032156934.1 hypothetical protein -
O1A30_RS23890 (O1A30_23890) 36152..37078 + 927 WP_000617209.1 WYL domain-containing protein -
O1A30_RS23895 (O1A30_23895) 37088..37687 + 600 WP_001021938.1 DUF1819 family protein -
O1A30_RS23900 (O1A30_23900) 37684..38268 + 585 WP_000645940.1 DUF1788 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / qnrS1 - 1..84390 84390
- inside IScluster/Tn - - 30275..35331 5056


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T273179 WP_001384452.1 NZ_CP118538:c33704-33426 [Salmonella enterica subsp. enterica serovar Typhi]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10321.69 Da        Isoelectric Point: 8.8725

>AT273179 WP_021546940.1 NZ_CP118538:c33973-33704 [Salmonella enterica subsp. enterica serovar Typhi]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLERGDVLPHDMVESSAAAWRD
EMRRKVADK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A1M1SX19

References