Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4533446..4534062 Replicon chromosome
Accession NZ_CP118537
Organism Salmonella enterica subsp. enterica serovar Typhi strain S3

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag O1A30_RS22240 Protein ID WP_000238494.1
Coordinates 4533446..4533820 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag O1A30_RS22245 Protein ID WP_001523745.1
Coordinates 4533820..4534062 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O1A30_RS22225 (O1A30_22225) 4530948..4531850 + 903 WP_000331359.1 formate dehydrogenase subunit beta -
O1A30_RS22230 (O1A30_22230) 4531847..4532482 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
O1A30_RS22235 (O1A30_22235) 4532479..4533408 + 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
O1A30_RS22240 (O1A30_22240) 4533446..4533820 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
O1A30_RS22245 (O1A30_22245) 4533820..4534062 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
O1A30_RS22250 (O1A30_22250) 4534267..4535196 + 930 WP_001162859.1 alpha/beta hydrolase -
O1A30_RS22255 (O1A30_22255) 4535282..4535593 + 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin -
O1A30_RS22260 (O1A30_22260) 4535590..4536036 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
O1A30_RS22265 (O1A30_22265) 4536051..4536992 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
O1A30_RS22270 (O1A30_22270) 4537037..4537474 - 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
O1A30_RS22275 (O1A30_22275) 4537471..4538343 - 873 WP_000921423.1 virulence factor BrkB family protein -
O1A30_RS22280 (O1A30_22280) 4538337..4538936 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T273177 WP_000238494.1 NZ_CP118537:c4533820-4533446 [Salmonella enterica subsp. enterica serovar Typhi]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT273177 WP_001523745.1 NZ_CP118537:c4534062-4533820 [Salmonella enterica subsp. enterica serovar Typhi]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References