Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 849642..850267 | Replicon | chromosome |
| Accession | NZ_CP118537 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain S3 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | O1A30_RS04180 | Protein ID | WP_000911334.1 |
| Coordinates | 849869..850267 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | O1A30_RS04175 | Protein ID | WP_000557549.1 |
| Coordinates | 849642..849869 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1A30_RS04145 (O1A30_04145) | 845191..845676 | + | 486 | WP_000082606.1 | hypothetical protein | - |
| O1A30_RS04150 (O1A30_04150) | 845679..845876 | + | 198 | WP_001240756.1 | hypothetical protein | - |
| O1A30_RS04155 (O1A30_04155) | 845999..846490 | + | 492 | WP_044790498.1 | hypothetical protein | - |
| O1A30_RS04160 (O1A30_04160) | 846572..847561 | + | 990 | WP_274844510.1 | hypothetical protein | - |
| O1A30_RS04165 (O1A30_04165) | 848133..848939 | - | 807 | WP_077905073.1 | DUF1460 domain-containing protein | - |
| O1A30_RS04170 (O1A30_04170) | 849214..849465 | - | 252 | WP_001540858.1 | hypothetical protein | - |
| O1A30_RS04175 (O1A30_04175) | 849642..849869 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| O1A30_RS04180 (O1A30_04180) | 849869..850267 | + | 399 | WP_000911334.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| O1A30_RS04185 (O1A30_04185) | 851074..851610 | + | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
| O1A30_RS04190 (O1A30_04190) | 851657..852289 | + | 633 | WP_000835268.1 | YfdX family protein | - |
| O1A30_RS04195 (O1A30_04195) | 853008..853589 | + | 582 | WP_001244646.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 843247..858712 | 15465 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15091.44 Da Isoelectric Point: 7.7785
>T273166 WP_000911334.1 NZ_CP118537:849869-850267 [Salmonella enterica subsp. enterica serovar Typhi]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|