Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4636869..4637485 Replicon chromosome
Accession NZ_CP118536
Organism Salmonella enterica subsp. enterica serovar Typhi strain S7

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag PWA19_RS22825 Protein ID WP_000238494.1
Coordinates 4636869..4637243 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag PWA19_RS22830 Protein ID WP_001523745.1
Coordinates 4637243..4637485 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWA19_RS22810 (PWA19_22810) 4634371..4635273 + 903 WP_000331359.1 formate dehydrogenase subunit beta -
PWA19_RS22815 (PWA19_22815) 4635270..4635905 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
PWA19_RS22820 (PWA19_22820) 4635902..4636831 + 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
PWA19_RS22825 (PWA19_22825) 4636869..4637243 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
PWA19_RS22830 (PWA19_22830) 4637243..4637485 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
PWA19_RS22835 (PWA19_22835) 4637690..4638619 + 930 WP_001162859.1 alpha/beta hydrolase -
PWA19_RS22840 (PWA19_22840) 4638705..4639016 + 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin -
PWA19_RS22845 (PWA19_22845) 4639013..4639459 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
PWA19_RS22850 (PWA19_22850) 4639474..4640415 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
PWA19_RS22855 (PWA19_22855) 4640460..4640897 - 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
PWA19_RS22860 (PWA19_22860) 4640894..4641766 - 873 WP_000921423.1 virulence factor BrkB family protein -
PWA19_RS22865 (PWA19_22865) 4641760..4642359 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T273162 WP_000238494.1 NZ_CP118536:c4637243-4636869 [Salmonella enterica subsp. enterica serovar Typhi]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT273162 WP_001523745.1 NZ_CP118536:c4637485-4637243 [Salmonella enterica subsp. enterica serovar Typhi]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References