Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 1751318..1751865 Replicon chromosome
Accession NZ_CP118532
Organism Vibrio harveyi strain 160-19

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PWS06_RS08660 Protein ID WP_258455559.1
Coordinates 1751563..1751865 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PWS06_RS08655 Protein ID WP_274790777.1
Coordinates 1751318..1751575 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWS06_RS08600 1746356..1746874 + 519 WP_258455562.1 DUF2778 domain-containing protein -
PWS06_RS08605 1746864..1747232 + 369 WP_053350296.1 DUF2195 family protein -
PWS06_RS08610 1747225..1747348 + 124 Protein_1612 DUF3265 domain-containing protein -
PWS06_RS08615 1747808..1747903 + 96 WP_237359304.1 DUF3265 domain-containing protein -
PWS06_RS08620 1748174..1748647 + 474 WP_208631279.1 hypothetical protein -
PWS06_RS08625 1748653..1749120 + 468 WP_123947169.1 hypothetical protein -
PWS06_RS08630 1749405..1749653 + 249 Protein_1616 BrnT family toxin -
PWS06_RS08635 1749853..1750008 + 156 WP_017190350.1 hypothetical protein -
PWS06_RS08640 1750277..1750711 + 435 WP_274790774.1 T6SS effector amidase Tae4 family protein -
PWS06_RS08645 1750708..1751124 + 417 WP_274790775.1 hypothetical protein -
PWS06_RS08650 1751159..1751236 + 78 WP_226982105.1 DUF3265 domain-containing protein -
PWS06_RS08655 1751318..1751575 + 258 WP_274790777.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWS06_RS08660 1751563..1751865 + 303 WP_258455559.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWS06_RS08665 1751909..1752061 - 153 Protein_1623 IS30 family transposase -
PWS06_RS08670 1752390..1752662 + 273 WP_050903611.1 hypothetical protein -
PWS06_RS08675 1752656..1752775 + 120 WP_080585338.1 DUF3265 domain-containing protein -
PWS06_RS08680 1752898..1752978 + 81 Protein_1626 GNAT family N-acetyltransferase -
PWS06_RS08685 1754220..1754471 + 252 WP_017817975.1 DUF2442 domain-containing protein -
PWS06_RS08690 1755137..1755382 + 246 WP_017817976.1 hypothetical protein -
PWS06_RS08695 1755515..1755970 + 456 WP_274790778.1 hypothetical protein -
PWS06_RS08700 1756031..1756477 + 447 WP_017817978.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1692376..1757015 64639
- inside Integron - - 1691096..1751575 60479


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-90)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11623.59 Da        Isoelectric Point: 7.9971

>T273148 WP_258455559.1 NZ_CP118532:1751563-1751865 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPDLKHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERGLRKFLLNKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9590.14 Da        Isoelectric Point: 7.3177

>AT273148 WP_274790777.1 NZ_CP118532:1751318-1751575 [Vibrio harveyi]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKVKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References