Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1730862..1731390 Replicon chromosome
Accession NZ_CP118532
Organism Vibrio harveyi strain 160-19

Toxin (Protein)


Gene name relE Uniprot ID K5TRR0
Locus tag PWS06_RS08435 Protein ID WP_005377002.1
Coordinates 1730862..1731152 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR02
Locus tag PWS06_RS08440 Protein ID WP_005377003.1
Coordinates 1731142..1731390 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWS06_RS08360 1726152..1726241 + 90 WP_274790821.1 DUF3265 domain-containing protein -
PWS06_RS08365 1726268..1726660 + 393 WP_274790759.1 hypothetical protein -
PWS06_RS08370 1726675..1726767 + 93 WP_012841722.1 DUF3265 domain-containing protein -
PWS06_RS08375 1726795..1727199 + 405 WP_038899606.1 DUF2513 domain-containing protein -
PWS06_RS08380 1727196..1727306 + 111 WP_274790822.1 DUF3265 domain-containing protein -
PWS06_RS08385 1727335..1727808 + 474 WP_274790760.1 GrpB family protein -
PWS06_RS08390 1727823..1727915 + 93 WP_080258441.1 DUF3265 domain-containing protein -
PWS06_RS08395 1727943..1728452 + 510 WP_198421128.1 hypothetical protein -
PWS06_RS08400 1728473..1728565 + 93 WP_079399821.1 DUF3265 domain-containing protein -
PWS06_RS08405 1728631..1728843 + 213 WP_274790761.1 hypothetical protein -
PWS06_RS08410 1729000..1729455 + 456 WP_274790762.1 hypothetical protein -
PWS06_RS08415 1729470..1729562 + 93 WP_004748931.1 DUF3265 domain-containing protein -
PWS06_RS08420 1729601..1730029 + 429 WP_154203549.1 hypothetical protein -
PWS06_RS08425 1730182..1730736 + 555 WP_274790763.1 hypothetical protein -
PWS06_RS08430 1730751..1730843 + 93 WP_074531793.1 DUF3265 domain-containing protein -
PWS06_RS08435 1730862..1731152 - 291 WP_005377002.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWS06_RS08440 1731142..1731390 - 249 WP_005377003.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWS06_RS08445 1731465..1731533 + 69 WP_074531725.1 DUF3265 domain-containing protein -
PWS06_RS08450 1731976..1732105 + 130 Protein_1580 DUF3265 domain-containing protein -
PWS06_RS08455 1732524..1732652 + 129 WP_102387257.1 DUF3265 domain-containing protein -
PWS06_RS08460 1732688..1733062 + 375 WP_274790767.1 hypothetical protein -
PWS06_RS08465 1733670..1733762 + 93 WP_079863846.1 DUF3265 domain-containing protein -
PWS06_RS08470 1733788..1734591 + 804 WP_274790768.1 DUF3800 domain-containing protein -
PWS06_RS08475 1734587..1734655 + 69 Protein_1585 DUF3265 domain-containing protein -
PWS06_RS08480 1735144..1735233 + 90 WP_079771541.1 DUF3265 domain-containing protein -
PWS06_RS08485 1735274..1735741 + 468 WP_230544375.1 DUF4476 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1692376..1757015 64639
- inside Integron - - 1691096..1751575 60479


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(12-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11261.25 Da        Isoelectric Point: 10.5932

>T273147 WP_005377002.1 NZ_CP118532:c1731152-1730862 [Vibrio harveyi]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9079.37 Da        Isoelectric Point: 3.9610

>AT273147 WP_005377003.1 NZ_CP118532:c1731390-1731142 [Vibrio harveyi]
MTTRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAEAYEMMMDRLEDLELLAIAKERESEESISVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR03

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR02

References