Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 1720391..1720950 Replicon chromosome
Accession NZ_CP118532
Organism Vibrio harveyi strain 160-19

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PWS06_RS08305 Protein ID WP_069523642.1
Coordinates 1720391..1720669 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR21
Locus tag PWS06_RS08310 Protein ID WP_005398409.1
Coordinates 1720666..1720950 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWS06_RS08250 1715412..1716239 + 828 WP_274790750.1 hypothetical protein -
PWS06_RS08255 1716264..1716356 + 93 WP_074531784.1 DUF3265 domain-containing protein -
PWS06_RS08260 1716404..1717027 + 624 WP_274790751.1 hypothetical protein -
PWS06_RS08265 1717057..1717149 + 93 WP_274790819.1 DUF3265 domain-containing protein -
PWS06_RS08270 1717178..1717705 + 528 WP_274790752.1 CbrC family protein -
PWS06_RS08275 1717726..1717818 + 93 WP_004748931.1 DUF3265 domain-containing protein -
PWS06_RS08280 1717918..1718181 - 264 WP_257878794.1 hypothetical protein -
PWS06_RS08285 1718349..1718438 + 90 WP_072609953.1 DUF3265 domain-containing protein -
PWS06_RS08290 1718479..1719363 + 885 WP_274790753.1 hypothetical protein -
PWS06_RS08295 1719378..1719470 + 93 WP_274790754.1 DUF3265 domain-containing protein -
PWS06_RS08300 1719506..1720276 + 771 WP_274790755.1 N-acetyltransferase -
PWS06_RS08305 1720391..1720669 - 279 WP_069523642.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
PWS06_RS08310 1720666..1720950 - 285 WP_005398409.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PWS06_RS08315 1721698..1722219 + 522 WP_274790756.1 hypothetical protein -
PWS06_RS08320 1722357..1722890 + 534 WP_069534707.1 cysteine hydrolase family protein -
PWS06_RS08325 1723031..1723522 + 492 WP_274790757.1 hypothetical protein -
PWS06_RS08330 1723495..1723575 + 81 Protein_1556 DUF3265 domain-containing protein -
PWS06_RS08335 1723718..1724518 + 801 WP_154203547.1 hypothetical protein -
PWS06_RS08340 1724533..1724625 + 93 WP_079399843.1 DUF3265 domain-containing protein -
PWS06_RS08345 1724661..1725680 + 1020 WP_263123011.1 glycosaminoglycan attachment site -
PWS06_RS08350 1725705..1725794 + 90 WP_274790820.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1692376..1757015 64639
- inside Integron - - 1691096..1751575 60479


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10905.60 Da        Isoelectric Point: 4.3430

>T273146 WP_069523642.1 NZ_CP118532:c1720669-1720391 [Vibrio harveyi]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWLEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11069.40 Da        Isoelectric Point: 9.2167

>AT273146 WP_005398409.1 NZ_CP118532:c1720950-1720666 [Vibrio harveyi]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR21

References