Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 1705467..1706014 Replicon chromosome
Accession NZ_CP118532
Organism Vibrio harveyi strain 160-19

Toxin (Protein)


Gene name relE Uniprot ID I3NI64
Locus tag PWS06_RS08140 Protein ID WP_011080278.1
Coordinates 1705712..1706014 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U3A269
Locus tag PWS06_RS08135 Protein ID WP_005448240.1
Coordinates 1705467..1705724 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWS06_RS08075 1700493..1700876 + 384 WP_274790735.1 SMI1/KNR4 family protein -
PWS06_RS08080 1700902..1700994 + 93 WP_140290740.1 DUF3265 domain-containing protein -
PWS06_RS08085 1701023..1701553 + 531 WP_274790736.1 hypothetical protein -
PWS06_RS08090 1701704..1702045 + 342 WP_274790737.1 hypothetical protein -
PWS06_RS08095 1702020..1702160 + 141 WP_274790738.1 DUF3265 domain-containing protein -
PWS06_RS08100 1702581..1702710 + 130 Protein_1510 DUF3265 domain-containing protein -
PWS06_RS08105 1702747..1703511 + 765 WP_274790739.1 hypothetical protein -
PWS06_RS08110 1704018..1704095 + 78 Protein_1512 DUF3265 domain-containing protein -
PWS06_RS08115 1704222..1704566 + 345 WP_050936570.1 hypothetical protein -
PWS06_RS08120 1704590..1704682 + 93 WP_109174107.1 DUF3265 domain-containing protein -
PWS06_RS08125 1704715..1705278 + 564 WP_143692585.1 hypothetical protein -
PWS06_RS08130 1705296..1705385 + 90 WP_071881309.1 DUF3265 domain-containing protein -
PWS06_RS08135 1705467..1705724 + 258 WP_005448240.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWS06_RS08140 1705712..1706014 + 303 WP_011080278.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWS06_RS08145 1706050..1706141 + 92 Protein_1519 DUF3265 domain-containing protein -
PWS06_RS08150 1706339..1707328 + 990 WP_158131206.1 RES family NAD+ phosphorylase -
PWS06_RS08155 1707350..1707442 + 93 Protein_1521 DUF3265 domain-containing protein -
PWS06_RS08160 1707470..1707721 + 252 WP_274790741.1 hypothetical protein -
PWS06_RS08165 1707760..1707852 + 93 WP_274790742.1 DUF3265 domain-containing protein -
PWS06_RS08170 1707890..1708243 + 354 WP_274790743.1 hypothetical protein -
PWS06_RS08175 1708384..1708779 + 396 WP_047124129.1 DUF3465 domain-containing protein -
PWS06_RS08180 1708809..1708898 + 90 WP_071652537.1 DUF3265 domain-containing protein -
PWS06_RS08185 1708943..1709464 + 522 WP_274790744.1 hypothetical protein -
PWS06_RS08190 1709631..1710416 + 786 WP_274790745.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1692376..1757015 64639
- inside Integron - - 1691096..1751575 60479


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11624.53 Da        Isoelectric Point: 4.8951

>T273145 WP_011080278.1 NZ_CP118532:1705712-1706014 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQAIFSKVERLEAFPESGRIPPELEHLSYREVVVNPCRIFYKQDGDKV
FILFVMRAERDLRKFLLSKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9606.10 Da        Isoelectric Point: 6.7269

>AT273145 WP_005448240.1 NZ_CP118532:1705467-1705724 [Vibrio harveyi]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKDKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3Q0L5T4

Antitoxin

Source ID Structure
AlphaFold DB A0A432DGX8

References