Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 1407837..1408384 Replicon chromosome
Accession NZ_CP118530
Organism Vibrio harveyi strain A2

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PUT85_RS07050 Protein ID WP_258455559.1
Coordinates 1408082..1408384 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PUT85_RS07045 Protein ID WP_274790777.1
Coordinates 1407837..1408094 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUT85_RS06990 1402875..1403393 + 519 WP_258455562.1 DUF2778 domain-containing protein -
PUT85_RS06995 1403383..1403751 + 369 WP_053350296.1 DUF2195 family protein -
PUT85_RS07000 1403744..1403867 + 124 Protein_1308 DUF3265 domain-containing protein -
PUT85_RS07005 1404327..1404422 + 96 WP_237359304.1 DUF3265 domain-containing protein -
PUT85_RS07010 1404747..1405166 + 420 WP_230544371.1 hypothetical protein -
PUT85_RS07015 1405172..1405639 + 468 WP_123947169.1 hypothetical protein -
PUT85_RS07020 1405933..1406172 + 240 WP_005445666.1 BrnT family toxin -
PUT85_RS07025 1406372..1406527 + 156 WP_017190350.1 hypothetical protein -
PUT85_RS07030 1406796..1407230 + 435 WP_274790774.1 T6SS effector amidase Tae4 family protein -
PUT85_RS07035 1407227..1407643 + 417 WP_274790775.1 hypothetical protein -
PUT85_RS07040 1407678..1407755 + 78 WP_226982105.1 DUF3265 domain-containing protein -
PUT85_RS07045 1407837..1408094 + 258 WP_274790777.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PUT85_RS07050 1408082..1408384 + 303 WP_258455559.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PUT85_RS07055 1408428..1408580 - 153 Protein_1319 IS30 family transposase -
PUT85_RS07060 1408909..1409181 + 273 WP_050903611.1 hypothetical protein -
PUT85_RS07065 1409175..1409294 + 120 WP_080585338.1 DUF3265 domain-containing protein -
PUT85_RS07070 1409417..1409497 + 81 Protein_1322 GNAT family N-acetyltransferase -
PUT85_RS07075 1410739..1410990 + 252 WP_017817975.1 DUF2442 domain-containing protein -
PUT85_RS07080 1411656..1411901 + 246 WP_017817976.1 hypothetical protein -
PUT85_RS07085 1412034..1412489 + 456 WP_274790778.1 hypothetical protein -
PUT85_RS07090 1412550..1412996 + 447 WP_017817978.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1347832..1413534 65702
- inside Integron - - 1346552..1408094 61542


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-90)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11623.59 Da        Isoelectric Point: 7.9971

>T273144 WP_258455559.1 NZ_CP118530:1408082-1408384 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPDLKHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERGLRKFLLNKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9590.14 Da        Isoelectric Point: 7.3177

>AT273144 WP_274790777.1 NZ_CP118530:1407837-1408094 [Vibrio harveyi]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKVKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References