Detailed information of TA system TA273142

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/RelE-RelB
• Location: 1376910..1377469
• Replicon: chromosome
• Accession: NZ_CP118530
• Organism: Vibrio harveyi strain A2

Toxin (Protein)

• Gene name: relE
• Uniprot ID: -
• Locus tag: PUT85_RS06695
• Protein ID: WP_069523642.1
• Coordinates: 1376910..1377188 (-)
• Length: 93 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: A0A347UR21
• Locus tag: PUT85_RS06700
• Protein ID: WP_005398409.1
• Coordinates: 1377185..1377469 (-)
• Length: 95 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PUT85_RS06640	1371931..1372758	+	828	WP_274790750.1	hypothetical protein	-
PUT85_RS06645	1372783..1372875	+	93	WP_074531784.1	DUF3265 domain-containing protein	-
PUT85_RS06650	1372923..1373546	+	624	WP_274790751.1	hypothetical protein	-
PUT85_RS06655	1373576..1373668	+	93	WP_274790819.1	DUF3265 domain-containing protein	-
PUT85_RS06660	1373697..1374224	+	528	WP_274790752.1	CbrC family protein	-
PUT85_RS06665	1374245..1374337	+	93	WP_004748931.1	DUF3265 domain-containing protein	-
PUT85_RS06670	1374437..1374700	-	264	WP_257878794.1	hypothetical protein	-
PUT85_RS06675	1374868..1374957	+	90	WP_072609953.1	DUF3265 domain-containing protein	-
PUT85_RS06680	1374998..1375882	+	885	WP_274790753.1	hypothetical protein	-
PUT85_RS06685	1375897..1375989	+	93	WP_274790754.1	DUF3265 domain-containing protein	-
PUT85_RS06690	1376025..1376795	+	771	WP_274790755.1	N-acetyltransferase	-
PUT85_RS06695	1376910..1377188	-	279	WP_069523642.1	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	Toxin
PUT85_RS06700	1377185..1377469	-	285	WP_005398409.1	type II toxin-antitoxin system RelB/DinJ family antitoxin	Antitoxin
PUT85_RS06705	1378217..1378738	+	522	WP_274790756.1	hypothetical protein	-
PUT85_RS06710	1378876..1379409	+	534	WP_069534707.1	cysteine hydrolase family protein	-
PUT85_RS06715	1379550..1380041	+	492	WP_274790757.1	hypothetical protein	-
PUT85_RS06720	1380014..1380094	+	81	Protein_1252	DUF3265 domain-containing protein	-
PUT85_RS06725	1380237..1381037	+	801	WP_154203547.1	hypothetical protein	-
PUT85_RS06730	1381052..1381144	+	93	WP_079399843.1	DUF3265 domain-containing protein	-
PUT85_RS06735	1381180..1382199	+	1020	WP_263123011.1	glycosaminoglycan attachment site	-
PUT85_RS06740	1382224..1382313	+	90	WP_274790820.1	DUF3265 domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	-	-	1347832..1413534	65702
	-	inside	Integron	-	-	1346552..1408094	61542

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (2-89)

Antitoxin

• RelB antitoxin/Antitoxin DinJ (5-69)

Sequences

Toxin

Protein

• Length: 93 a.a.
• Molecular weight: 10905.60 Da
• Isoelectric Point: 4.3430

>T273142 WP_069523642.1 NZ_CP118530:c1377188-1376910 [Vibrio harveyi]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWLEGDIIRVM
RVLHQKQKFPTD

Nucleotide

• Length: 279 bp

Antitoxin

Protein

• Length: 95 a.a.
• Molecular weight: 11069.40 Da
• Isoelectric Point: 9.2167

>AT273142 WP_005398409.1 NZ_CP118530:c1377469-1377185 [Vibrio harveyi]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ

Nucleotide

• Length: 285 bp

Structures

Antitoxin

• AlphaFold DB: A0A347UR21