Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 1361986..1362533 Replicon chromosome
Accession NZ_CP118530
Organism Vibrio harveyi strain A2

Toxin (Protein)


Gene name relE Uniprot ID I3NI64
Locus tag PUT85_RS06530 Protein ID WP_011080278.1
Coordinates 1362231..1362533 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U3A269
Locus tag PUT85_RS06525 Protein ID WP_005448240.1
Coordinates 1361986..1362243 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUT85_RS06465 1357012..1357395 + 384 WP_274790735.1 SMI1/KNR4 family protein -
PUT85_RS06470 1357421..1357513 + 93 WP_140290740.1 DUF3265 domain-containing protein -
PUT85_RS06475 1357542..1358072 + 531 WP_274790736.1 hypothetical protein -
PUT85_RS06480 1358223..1358564 + 342 WP_274790737.1 hypothetical protein -
PUT85_RS06485 1358539..1358679 + 141 WP_274790738.1 DUF3265 domain-containing protein -
PUT85_RS06490 1359100..1359229 + 130 Protein_1206 DUF3265 domain-containing protein -
PUT85_RS06495 1359266..1360030 + 765 WP_274790739.1 hypothetical protein -
PUT85_RS06500 1360537..1360614 + 78 Protein_1208 DUF3265 domain-containing protein -
PUT85_RS06505 1360741..1361085 + 345 WP_050936570.1 hypothetical protein -
PUT85_RS06510 1361109..1361201 + 93 WP_109174107.1 DUF3265 domain-containing protein -
PUT85_RS06515 1361234..1361797 + 564 WP_143692585.1 hypothetical protein -
PUT85_RS06520 1361815..1361904 + 90 WP_071881309.1 DUF3265 domain-containing protein -
PUT85_RS06525 1361986..1362243 + 258 WP_005448240.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PUT85_RS06530 1362231..1362533 + 303 WP_011080278.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PUT85_RS06535 1362569..1362660 + 92 Protein_1215 DUF3265 domain-containing protein -
PUT85_RS06540 1362858..1363847 + 990 WP_158131206.1 RES family NAD+ phosphorylase -
PUT85_RS06545 1363869..1363961 + 93 Protein_1217 DUF3265 domain-containing protein -
PUT85_RS06550 1363989..1364240 + 252 WP_274790741.1 hypothetical protein -
PUT85_RS06555 1364279..1364371 + 93 WP_274790742.1 DUF3265 domain-containing protein -
PUT85_RS06560 1364409..1364762 + 354 WP_274790743.1 hypothetical protein -
PUT85_RS06565 1364903..1365298 + 396 WP_047124129.1 DUF3465 domain-containing protein -
PUT85_RS06570 1365328..1365417 + 90 WP_071652537.1 DUF3265 domain-containing protein -
PUT85_RS06575 1365462..1365983 + 522 WP_274790744.1 hypothetical protein -
PUT85_RS06580 1366150..1366935 + 786 WP_274790745.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1347832..1413534 65702
- inside Integron - - 1346552..1408094 61542


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11624.53 Da        Isoelectric Point: 4.8951

>T273141 WP_011080278.1 NZ_CP118530:1362231-1362533 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQAIFSKVERLEAFPESGRIPPELEHLSYREVVVNPCRIFYKQDGDKV
FILFVMRAERDLRKFLLSKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9606.10 Da        Isoelectric Point: 6.7269

>AT273141 WP_005448240.1 NZ_CP118530:1361986-1362243 [Vibrio harveyi]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKDKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3Q0L5T4

Antitoxin

Source ID Structure
AlphaFold DB A0A432DGX8

References