Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 2846988..2847535 | Replicon | chromosome |
Accession | NZ_CP118528 | ||
Organism | Vibrio harveyi strain 94/17 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PWS04_RS13745 | Protein ID | WP_258455559.1 |
Coordinates | 2847233..2847535 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A454B3H2 |
Locus tag | PWS04_RS13740 | Protein ID | WP_005445660.1 |
Coordinates | 2846988..2847245 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWS04_RS13690 | 2842114..2842365 | + | 252 | WP_274791738.1 | hypothetical protein | - |
PWS04_RS13695 | 2842484..2842577 | + | 94 | Protein_2592 | DUF3265 domain-containing protein | - |
PWS04_RS13700 | 2842608..2843273 | + | 666 | WP_274791739.1 | hypothetical protein | - |
PWS04_RS13705 | 2843433..2844818 | + | 1386 | WP_274791740.1 | hypothetical protein | - |
PWS04_RS13710 | 2844957..2845256 | + | 300 | WP_005536942.1 | hypothetical protein | - |
PWS04_RS13715 | 2845253..2845321 | + | 69 | Protein_2596 | DUF3265 domain-containing protein | - |
PWS04_RS13720 | 2845458..2845901 | + | 444 | WP_274791741.1 | GNAT family N-acetyltransferase | - |
PWS04_RS13725 | 2846196..2846420 | + | 225 | WP_274791742.1 | BrnT family toxin | - |
PWS04_RS13730 | 2846458..2846637 | + | 180 | WP_017190351.1 | hypothetical protein | - |
PWS04_RS13735 | 2846634..2846789 | + | 156 | WP_017190350.1 | hypothetical protein | - |
PWS04_RS13740 | 2846988..2847245 | + | 258 | WP_005445660.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PWS04_RS13745 | 2847233..2847535 | + | 303 | WP_258455559.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PWS04_RS13750 | 2847579..2847731 | - | 153 | Protein_2603 | IS30 family transposase | - |
PWS04_RS13755 | 2848060..2848332 | + | 273 | WP_050903611.1 | hypothetical protein | - |
PWS04_RS13760 | 2848326..2848445 | + | 120 | WP_080585338.1 | DUF3265 domain-containing protein | - |
PWS04_RS13765 | 2848501..2848917 | + | 417 | WP_274791743.1 | hypothetical protein | - |
PWS04_RS13770 | 2849125..2849556 | + | 432 | WP_045490299.1 | GNAT family N-acetyltransferase | - |
PWS04_RS13775 | 2850803..2851054 | + | 252 | WP_017817975.1 | DUF2442 domain-containing protein | - |
PWS04_RS13780 | 2851720..2851965 | + | 246 | WP_222326331.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2816228..2853598 | 37370 | |
- | inside | Integron | - | - | 2815626..2845901 | 30275 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11623.59 Da Isoelectric Point: 7.9971
>T273140 WP_258455559.1 NZ_CP118528:2847233-2847535 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPDLKHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERGLRKFLLNKQ
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPDLKHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERGLRKFLLNKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|