Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 2836431..2836990 Replicon chromosome
Accession NZ_CP118528
Organism Vibrio harveyi strain 94/17

Toxin (Protein)


Gene name relE Uniprot ID A0A347UR22
Locus tag PWS04_RS13610 Protein ID WP_005398411.1
Coordinates 2836431..2836709 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR21
Locus tag PWS04_RS13615 Protein ID WP_005398409.1
Coordinates 2836706..2836990 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWS04_RS13545 2831767..2831859 + 93 WP_080338837.1 DUF3265 domain-containing protein -
PWS04_RS13550 2831953..2832372 + 420 WP_077200592.1 hypothetical protein -
PWS04_RS13555 2832408..2832500 + 93 WP_199436720.1 DUF3265 domain-containing protein -
PWS04_RS13560 2832531..2832965 + 435 WP_274791731.1 GNAT family N-acetyltransferase -
PWS04_RS13565 2833450..2833539 + 90 WP_071881309.1 DUF3265 domain-containing protein -
PWS04_RS13570 2833565..2834017 + 453 WP_274791732.1 hypothetical protein -
PWS04_RS13575 2834035..2834124 + 90 WP_201258222.1 DUF3265 domain-containing protein -
PWS04_RS13580 2834152..2834838 + 687 WP_047517854.1 GIY-YIG nuclease family protein -
PWS04_RS13585 2834951..2835223 + 273 WP_009698352.1 hypothetical protein -
PWS04_RS13590 2835314..2835406 + 93 WP_079764584.1 DUF3265 domain-containing protein -
PWS04_RS13595 2835511..2835855 + 345 WP_017190364.1 hypothetical protein -
PWS04_RS13600 2835839..2836282 + 444 WP_017190363.1 hypothetical protein -
PWS04_RS13605 2836310..2836402 + 93 WP_196229928.1 DUF3265 domain-containing protein -
PWS04_RS13610 2836431..2836709 - 279 WP_005398411.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
PWS04_RS13615 2836706..2836990 - 285 WP_005398409.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PWS04_RS13620 2837067..2837158 + 92 Protein_2577 DUF3265 domain-containing protein -
PWS04_RS13625 2837208..2837633 + 426 WP_069525414.1 hypothetical protein -
PWS04_RS13630 2837685..2837774 + 90 WP_076665001.1 DUF3265 domain-containing protein -
PWS04_RS13635 2837878..2838144 + 267 WP_029863890.1 hypothetical protein -
PWS04_RS13640 2838148..2838216 + 69 Protein_2581 DUF3265 domain-containing protein -
PWS04_RS13645 2838305..2839036 + 732 WP_274791734.1 hypothetical protein -
PWS04_RS13650 2839057..2839149 + 93 WP_206635068.1 DUF3265 domain-containing protein -
PWS04_RS13655 2839189..2839578 + 390 WP_274791735.1 DUF4345 domain-containing protein -
PWS04_RS13660 2839596..2839685 + 90 WP_072615037.1 DUF3265 domain-containing protein -
PWS04_RS13665 2839716..2840159 + 444 WP_103155411.1 hypothetical protein -
PWS04_RS13670 2840156..2840275 + 120 WP_080573781.1 DUF3265 domain-containing protein -
PWS04_RS13675 2840348..2840716 - 369 WP_274791736.1 HNH endonuclease signature motif containing protein -
PWS04_RS13680 2840726..2841034 - 309 WP_274791737.1 hypothetical protein -
PWS04_RS13685 2841308..2841856 + 549 WP_203346253.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2816228..2853598 37370
- inside Integron - - 2815626..2845901 30275


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10891.57 Da        Isoelectric Point: 4.3430

>T273139 WP_005398411.1 NZ_CP118528:c2836709-2836431 [Vibrio harveyi]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11069.40 Da        Isoelectric Point: 9.2167

>AT273139 WP_005398409.1 NZ_CP118528:c2836990-2836706 [Vibrio harveyi]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR22

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR21

References