Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 471913..472550 | Replicon | chromosome |
Accession | NZ_CP118495 | ||
Organism | Bacillus velezensis strain FC02 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | PVT72_RS02435 | Protein ID | WP_003156187.1 |
Coordinates | 472200..472550 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | PVT72_RS02430 | Protein ID | WP_003156188.1 |
Coordinates | 471913..472194 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVT72_RS02410 (PVT72_02410) | 468278..468877 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
PVT72_RS02415 (PVT72_02415) | 468970..469335 | + | 366 | WP_003156192.1 | holo-ACP synthase | - |
PVT72_RS02420 (PVT72_02420) | 469500..470507 | + | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
PVT72_RS02425 (PVT72_02425) | 470624..471793 | + | 1170 | WP_003156189.1 | alanine racemase | - |
PVT72_RS02430 (PVT72_02430) | 471913..472194 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
PVT72_RS02435 (PVT72_02435) | 472200..472550 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PVT72_RS02440 (PVT72_02440) | 472668..473489 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
PVT72_RS02445 (PVT72_02445) | 473494..473859 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
PVT72_RS02450 (PVT72_02450) | 473862..474263 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
PVT72_RS02455 (PVT72_02455) | 474275..475282 | + | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
PVT72_RS02460 (PVT72_02460) | 475346..475675 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
PVT72_RS02465 (PVT72_02465) | 475672..476154 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
PVT72_RS02470 (PVT72_02470) | 476120..476908 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
PVT72_RS02475 (PVT72_02475) | 476908..477510 | + | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T273133 WP_003156187.1 NZ_CP118495:472200-472550 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|