Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumAB/upstrm_HI1419-dnstrm_HI1420
Location 3066803..3067406 Replicon chromosome
Accession NZ_CP118494
Organism Roseovarius tolerans strain EL-164

Toxin (Protein)


Gene name PumA Uniprot ID A0A3B0MJM6
Locus tag PVU19_RS15200 Protein ID WP_050664244.1
Coordinates 3066803..3067105 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name PumB Uniprot ID A0A3B0MRX7
Locus tag PVU19_RS15205 Protein ID WP_050664243.1
Coordinates 3067095..3067406 (+) Length 104 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PVU19_RS15160 3061990..3062622 + 633 WP_050664251.1 DUF6441 family protein -
PVU19_RS15165 3062673..3064109 - 1437 WP_050664250.1 mercury(II) reductase -
PVU19_RS15170 3064102..3064335 - 234 WP_121096992.1 mercury resistance system transport protein MerF -
PVU19_RS15175 3064340..3064645 - 306 WP_050664248.1 cation transporter -
PVU19_RS15180 3064664..3065053 - 390 WP_050664247.1 mercuric transporter MerT family protein -
PVU19_RS15185 3065130..3065555 + 426 WP_050664246.1 helix-turn-helix domain-containing protein -
PVU19_RS15190 3065552..3065857 + 306 Protein_3001 acyl-CoA transferase -
PVU19_RS15195 3066182..3066694 + 513 WP_050664245.1 transcriptional activator RfaH -
PVU19_RS15200 3066803..3067105 + 303 WP_050664244.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PVU19_RS15205 3067095..3067406 + 312 WP_050664243.1 putative addiction module antidote protein Antitoxin
PVU19_RS15210 3067821..3068814 + 994 WP_235575896.1 IS5 family transposase -
PVU19_RS15215 3068991..3069365 - 375 WP_050664242.1 helix-turn-helix transcriptional regulator -
PVU19_RS15220 3069370..3069723 - 354 WP_050664241.1 type II toxin-antitoxin system RelE/ParE family toxin -
PVU19_RS15225 3070039..3070605 - 567 WP_235575895.1 integrase core domain-containing protein -
PVU19_RS15230 3071010..3071714 + 705 WP_274789801.1 IS6 family transposase -
PVU19_RS15235 3071927..3072067 + 141 WP_160316383.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2958010..3071714 113704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-96)

Antitoxin

Uncharacterized protein HI1420

(5-91)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11777.46 Da        Isoelectric Point: 10.6462

>T273132 WP_050664244.1 NZ_CP118494:3066803-3067105 [Roseovarius tolerans]
MFVIRQTDIFSSWLRNLRDQRAKQKITSRLQRLKFGHFGDVEPVGHGVSEVRIHEGKGYRVYFRQQGDEIIFLLCGGDKK
SQQRDITKAQRIWKELGNET

Download         Length: 303 bp

Antitoxin


Download         Length: 104 a.a.        Molecular weight: 11073.48 Da        Isoelectric Point: 4.4843

>AT273132 WP_050664243.1 NZ_CP118494:3067095-3067406 [Roseovarius tolerans]
MKHEINDFDPAEYLDNDEMIAGYLSDALETQDPAFIADAIGVVARAKGMKRVAEDAGVSRESLYRALSANGNPEFGTVLK
VLASLNIKLIAQPDSVKPHNTAA

Download         Length: 312 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3B0MJM6

Antitoxin

Source ID Structure
AlphaFold DB A0A3B0MRX7

References