Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 1133264..1133826 | Replicon | chromosome |
| Accession | NZ_CP118494 | ||
| Organism | Roseovarius tolerans strain EL-164 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A0L6CZJ2 |
| Locus tag | PVU19_RS05560 | Protein ID | WP_050661008.1 |
| Coordinates | 1133264..1133572 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A0L6D0K9 |
| Locus tag | PVU19_RS05565 | Protein ID | WP_050661009.1 |
| Coordinates | 1133569..1133826 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVU19_RS05540 | 1128828..1129367 | - | 540 | WP_050661004.1 | NADPH-dependent FMN reductase | - |
| PVU19_RS05545 | 1129549..1130454 | - | 906 | WP_050661005.1 | LysR family transcriptional regulator | - |
| PVU19_RS05550 | 1130647..1131090 | + | 444 | WP_050661006.1 | DUF4399 domain-containing protein | - |
| PVU19_RS05555 | 1131097..1133124 | - | 2028 | WP_050661007.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| PVU19_RS05560 | 1133264..1133572 | - | 309 | WP_050661008.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PVU19_RS05565 | 1133569..1133826 | - | 258 | WP_050661009.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| PVU19_RS05570 | 1133891..1134313 | - | 423 | WP_050661010.1 | alternative ribosome rescue aminoacyl-tRNA hydrolase ArfB | - |
| PVU19_RS05575 | 1134624..1135544 | - | 921 | WP_050661011.1 | penicillin-insensitive murein endopeptidase | - |
| PVU19_RS05580 | 1135526..1136908 | - | 1383 | WP_050661012.1 | MFS transporter | - |
| PVU19_RS05585 | 1136964..1137512 | - | 549 | WP_050661013.1 | acyl-CoA thioesterase | - |
| PVU19_RS05590 | 1137644..1137931 | + | 288 | WP_050661014.1 | YggT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11626.12 Da Isoelectric Point: 6.7176
>T273131 WP_050661008.1 NZ_CP118494:c1133572-1133264 [Roseovarius tolerans]
VTEFRLTRTAVADLDDIWDHSKVTWGEQRAESYVTEIFACFSRAAAAPETGRDRSVFVPGARSLPVGRHLVFYRMVGPDV
VILRVVHERRNWAALSFAYDQD
VTEFRLTRTAVADLDDIWDHSKVTWGEQRAESYVTEIFACFSRAAAAPETGRDRSVFVPGARSLPVGRHLVFYRMVGPDV
VILRVVHERRNWAALSFAYDQD
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0L6CZJ2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0L6D0K9 |