Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/YafN(antitoxin)
Location 274757..275322 Replicon chromosome
Accession NZ_CP118438
Organism Vibrio vulnificus strain 1908-10

Toxin (Protein)


Gene name relE Uniprot ID I3NI62
Locus tag PVE41_RS01190 Protein ID WP_011080400.1
Coordinates 274757..275044 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID I3NI65
Locus tag PVE41_RS01195 Protein ID WP_011080399.1
Coordinates 275041..275322 (-) Length 94 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PVE41_RS01130 (PVE41_01130) 269965..270105 - 141 WP_131070173.1 DUF3265 domain-containing protein -
PVE41_RS01135 (PVE41_01135) 270120..270911 - 792 WP_207308109.1 PhzF family phenazine biosynthesis protein -
PVE41_RS01140 (PVE41_01140) 271519..271611 - 93 WP_207308100.1 DUF3265 domain-containing protein -
PVE41_RS01145 (PVE41_01145) 271637..272170 - 534 WP_131069843.1 hypothetical protein -
PVE41_RS01150 (PVE41_01150) 272198..272314 - 117 WP_131070171.1 DUF3265 domain-containing protein -
PVE41_RS01155 (PVE41_01155) 272305..272814 - 510 WP_131069842.1 ClbS/DfsB family four-helix bundle protein -
PVE41_RS01160 (PVE41_01160) 272792..272963 - 172 Protein_231 DUF3265 domain-containing protein -
PVE41_RS01165 (PVE41_01165) 272950..273204 - 255 WP_131069841.1 hypothetical protein -
PVE41_RS01170 (PVE41_01170) 273248..273340 - 93 WP_079857208.1 DUF3265 domain-containing protein -
PVE41_RS01175 (PVE41_01175) 273367..273681 - 315 WP_207308099.1 hypothetical protein -
PVE41_RS01180 (PVE41_01180) 273705..273794 - 90 WP_080933288.1 DUF3265 domain-containing protein -
PVE41_RS01185 (PVE41_01185) 273820..274569 - 750 WP_207308098.1 hypothetical protein -
PVE41_RS01190 (PVE41_01190) 274757..275044 - 288 WP_011080400.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PVE41_RS01195 (PVE41_01195) 275041..275322 - 282 WP_011080399.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PVE41_RS01200 (PVE41_01200) 275866..276009 - 144 WP_080553518.1 DUF3265 domain-containing protein -
PVE41_RS01205 (PVE41_01205) 275991..276470 - 480 WP_011080398.1 GNAT family N-acetyltransferase -
PVE41_RS01210 (PVE41_01210) 276506..276598 - 93 WP_005377014.1 DUF3265 domain-containing protein -
PVE41_RS01215 (PVE41_01215) 276613..276942 - 330 WP_011080397.1 hypothetical protein -
PVE41_RS01220 (PVE41_01220) 277149..278117 + 969 WP_131069788.1 IS30-like element ISVa6 family transposase -
PVE41_RS01225 (PVE41_01225) 278361..279149 - 789 WP_282500001.1 hypothetical protein -
PVE41_RS01230 (PVE41_01230) 279304..279801 - 498 WP_043921032.1 hypothetical protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 251879..392377 140498
- flank IS/Tn - - 277185..278117 932
- inside Integron - - 255138..288955 33817


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 96 a.a.        Molecular weight: 10991.69 Da        Isoelectric Point: 5.0872

>T273125 WP_011080400.1 NZ_CP118438:c275044-274757 [Vibrio vulnificus]
MKVVWSPLALQKLGDAAEFISLDNPVAAESWVNEVFDKTELLSNMPEMGRMVPELPHTNYREILFGHYRIIYSLSHEIRV
LTVRNCRQMLTESDV

Download         Length: 288 bp


Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10426.96 Da        Isoelectric Point: 5.8719

>AT273125 WP_011080399.1 NZ_CP118438:c275322-275041 [Vibrio vulnificus]
MSRIHFDQDIQPLSEFRAGVTSFIKQINETRRPLVITQRGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLASGLGVSN
EDARAQVLGRIKK

Download         Length: 282 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A3Q0L634


Antitoxin

Source ID Structure
AlphaFold DB A0A3S0MQY5

References