Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4039852..4040471 Replicon chromosome
Accession NZ_CP118405
Organism Klebsiella pneumoniae strain F3-2P(2*)

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag HX883_RS19680 Protein ID WP_002892050.1
Coordinates 4040253..4040471 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag HX883_RS19675 Protein ID WP_002892066.1
Coordinates 4039852..4040226 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HX883_RS19665 (4035004) 4035004..4036197 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
HX883_RS19670 (4036220) 4036220..4039366 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
HX883_RS19675 (4039852) 4039852..4040226 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
HX883_RS19680 (4040253) 4040253..4040471 + 219 WP_002892050.1 HHA domain-containing protein Toxin
HX883_RS19685 (4040630) 4040630..4041196 + 567 WP_002892030.1 maltose O-acetyltransferase -
HX883_RS19690 (4041168) 4041168..4041308 - 141 WP_004147370.1 hypothetical protein -
HX883_RS19695 (4041329) 4041329..4041799 + 471 WP_002892026.1 YlaC family protein -
HX883_RS19700 (4041774) 4041774..4043225 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
HX883_RS19705 (4043326) 4043326..4044024 + 699 WP_002892021.1 GNAT family protein -
HX883_RS19710 (4044021) 4044021..4044161 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
HX883_RS19715 (4044161) 4044161..4044424 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T273120 WP_002892050.1 NZ_CP118405:4040253-4040471 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT273120 WP_002892066.1 NZ_CP118405:4039852-4040226 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References