Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4039852..4040471 | Replicon | chromosome |
| Accession | NZ_CP118405 | ||
| Organism | Klebsiella pneumoniae strain F3-2P(2*) | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | HX883_RS19680 | Protein ID | WP_002892050.1 |
| Coordinates | 4040253..4040471 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | HX883_RS19675 | Protein ID | WP_002892066.1 |
| Coordinates | 4039852..4040226 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HX883_RS19665 (4035004) | 4035004..4036197 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| HX883_RS19670 (4036220) | 4036220..4039366 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| HX883_RS19675 (4039852) | 4039852..4040226 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| HX883_RS19680 (4040253) | 4040253..4040471 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| HX883_RS19685 (4040630) | 4040630..4041196 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| HX883_RS19690 (4041168) | 4041168..4041308 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| HX883_RS19695 (4041329) | 4041329..4041799 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| HX883_RS19700 (4041774) | 4041774..4043225 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| HX883_RS19705 (4043326) | 4043326..4044024 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| HX883_RS19710 (4044021) | 4044021..4044161 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| HX883_RS19715 (4044161) | 4044161..4044424 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T273120 WP_002892050.1 NZ_CP118405:4040253-4040471 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT273120 WP_002892066.1 NZ_CP118405:4039852-4040226 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |