Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1755275..1755865 | Replicon | chromosome |
Accession | NZ_CP118405 | ||
Organism | Klebsiella pneumoniae strain F3-2P(2*) |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | HX883_RS08500 | Protein ID | WP_023341911.1 |
Coordinates | 1755533..1755865 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A3S7DDD0 |
Locus tag | HX883_RS08495 | Protein ID | WP_000288812.1 |
Coordinates | 1755275..1755532 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HX883_RS08470 (1751185) | 1751185..1751259 | + | 75 | Protein_1658 | type II toxin-antitoxin system PemK/MazF family toxin | - |
HX883_RS08475 (1751610) | 1751610..1753358 | + | 1749 | WP_032418698.1 | hypothetical protein | - |
HX883_RS08480 (1753412) | 1753412..1753993 | + | 582 | WP_099184326.1 | hypothetical protein | - |
HX883_RS08485 (1754276) | 1754276..1754737 | + | 462 | WP_004213450.1 | hypothetical protein | - |
HX883_RS08490 (1754734) | 1754734..1754940 | + | 207 | WP_020805021.1 | helix-turn-helix transcriptional regulator | - |
HX883_RS08495 (1755275) | 1755275..1755532 | + | 258 | WP_000288812.1 | antitoxin | Antitoxin |
HX883_RS08500 (1755533) | 1755533..1755865 | + | 333 | WP_023341911.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
HX883_RS08510 (1756187) | 1756187..1757623 | + | 1437 | WP_004151469.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
HX883_RS08520 (1757989) | 1757989..1759443 | - | 1455 | WP_004148975.1 | AMP nucleosidase | - |
HX883_RS08525 (1759573) | 1759573..1759818 | - | 246 | WP_004141189.1 | signal transduction protein PmrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11927.87 Da Isoelectric Point: 10.4722
>T273113 WP_023341911.1 NZ_CP118405:1755533-1755865 [Klebsiella pneumoniae]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDVVVNEVLARLDAMLS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDVVVNEVLARLDAMLS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|