Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 92346..92872 | Replicon | plasmid unnamed1 |
Accession | NZ_CP118399 | ||
Organism | Klebsiella pneumoniae strain 2020CK-00223 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | PWK27_RS26810 | Protein ID | WP_000323025.1 |
Coordinates | 92346..92633 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | J5W3H0 |
Locus tag | PWK27_RS26815 | Protein ID | WP_004196370.1 |
Coordinates | 92633..92872 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWK27_RS26785 (PWK27_26785) | 87659..87931 | - | 273 | WP_032425552.1 | hypothetical protein | - |
PWK27_RS26790 (PWK27_26790) | 88588..89556 | - | 969 | WP_072198477.1 | IS5 family transposase | - |
PWK27_RS26795 (PWK27_26795) | 89851..90957 | - | 1107 | Protein_102 | IS4-like element IS421 family transposase | - |
PWK27_RS26800 (PWK27_26800) | 91034..91152 | - | 119 | Protein_103 | type I toxin-antitoxin system Hok family toxin | - |
PWK27_RS26805 (PWK27_26805) | 91263..92295 | + | 1033 | Protein_104 | IS481 family transposase | - |
PWK27_RS26810 (PWK27_26810) | 92346..92633 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
PWK27_RS26815 (PWK27_26815) | 92633..92872 | - | 240 | WP_004196370.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
PWK27_RS26820 (PWK27_26820) | 92897..92995 | + | 99 | Protein_107 | protein YdfV | - |
PWK27_RS26825 (PWK27_26825) | 93123..93488 | + | 366 | WP_009651956.1 | hypothetical protein | - |
PWK27_RS26830 (PWK27_26830) | 93532..94269 | + | 738 | WP_008460272.1 | HupE/UreJ family protein | - |
PWK27_RS26835 (PWK27_26835) | 94283..94972 | + | 690 | WP_004196322.1 | hypothetical protein | - |
PWK27_RS26840 (PWK27_26840) | 95003..96379 | - | 1377 | Protein_111 | chromate efflux transporter | - |
PWK27_RS26845 (PWK27_26845) | 96336..97313 | - | 978 | WP_004196334.1 | chromate resistance protein | - |
PWK27_RS26850 (PWK27_26850) | 97343..97535 | + | 193 | Protein_113 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..136334 | 136334 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T273110 WP_000323025.1 NZ_CP118399:c92633-92346 [Klebsiella pneumoniae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|