Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 50414..51150 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP118399 | ||
| Organism | Klebsiella pneumoniae strain 2020CK-00223 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | PWK27_RS26585 | Protein ID | WP_064179701.1 |
| Coordinates | 50668..51150 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | PWK27_RS26580 | Protein ID | WP_003026799.1 |
| Coordinates | 50414..50680 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWK27_RS26540 (PWK27_26540) | 45777..47315 | + | 1539 | WP_004196907.1 | IS66-like element ISEc22 family transposase | - |
| PWK27_RS26545 (PWK27_26545) | 47605..47868 | + | 264 | WP_009310051.1 | hypothetical protein | - |
| PWK27_RS26550 (PWK27_26550) | 47865..48431 | + | 567 | WP_009310052.1 | hypothetical protein | - |
| PWK27_RS26555 (PWK27_26555) | 48462..48956 | + | 495 | WP_009310053.1 | hypothetical protein | - |
| PWK27_RS26560 (PWK27_26560) | 49000..49368 | + | 369 | WP_009310054.1 | hypothetical protein | - |
| PWK27_RS26565 (PWK27_26565) | 49399..49602 | + | 204 | WP_004098931.1 | HHA domain-containing protein | - |
| PWK27_RS26570 (PWK27_26570) | 49651..49908 | + | 258 | WP_004098928.1 | hypothetical protein | - |
| PWK27_RS26575 (PWK27_26575) | 49984..50238 | + | 255 | WP_004118702.1 | hypothetical protein | - |
| PWK27_RS26580 (PWK27_26580) | 50414..50680 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| PWK27_RS26585 (PWK27_26585) | 50668..51150 | + | 483 | WP_064179701.1 | GNAT family N-acetyltransferase | Toxin |
| PWK27_RS26590 (PWK27_26590) | 51309..52841 | - | 1533 | WP_009310015.1 | IS3-like element ISKpn38 family transposase | - |
| PWK27_RS26595 (PWK27_26595) | 52876..53454 | - | 579 | Protein_62 | urea ABC transporter permease subunit UrtB | - |
| PWK27_RS26600 (PWK27_26600) | 53511..54596 | - | 1086 | Protein_63 | urea ABC transporter substrate-binding protein | - |
| PWK27_RS26605 (PWK27_26605) | 54684..55710 | + | 1027 | Protein_64 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..136334 | 136334 | |
| - | inside | IScluster/Tn | - | - | 44980..67154 | 22174 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17307.95 Da Isoelectric Point: 9.5822
>T273109 WP_064179701.1 NZ_CP118399:50668-51150 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|